Align Imidazoleglycerol-phosphate dehydratase; Short=IGPD; EC 4.2.1.19 (characterized, see rationale)
to candidate WP_002719406.1 RSPH17029_RS04690 imidazoleglycerol-phosphate dehydratase HisB
Query= uniprot:Q9HU41 (197 letters) >NCBI__GCF_000015985.1:WP_002719406.1 Length = 195 Score = 233 bits (593), Expect = 2e-66 Identities = 109/194 (56%), Positives = 137/194 (70%) Query: 4 RKASVARDTLETQIKVSIDLDGTGKARFDTGVPFLDHMMDQIARHGLIDLDIECKGDLHI 63 RKA ++R T ET I V++DLDGTG+ TGV F DHMMDQ+ARH LID+ + C+GDLHI Sbjct: 2 RKAEISRKTAETDISVTVDLDGTGRYDIRTGVGFFDHMMDQLARHALIDITLRCEGDLHI 61 Query: 64 DDHHTVEDIGITLGQAFAKAIGDKKGIRRYGHAYVPLDEALSRVVIDFSGRPGLQMHVPF 123 DDHHTVED GI LGQA +A+GDK+GIRRYG ++ +D+AL R +D SGRP L ++PF Sbjct: 62 DDHHTVEDCGIALGQALTRALGDKRGIRRYGSFHLAMDDALVRAALDLSGRPFLVWNLPF 121 Query: 124 TRASVGGFDVDLFMEFFQGFVNHAQVTLHIDNLRGHNTHHQIETVFKAFGRALRMAIELD 183 +G FD +L EFFQ F H +TLH+D + G N+HH E FKA R+LR A+E D Sbjct: 122 PTEKIGSFDTELVREFFQAFATHGGITLHVDLIHGVNSHHIAEAAFKAVARSLREAVEPD 181 Query: 184 ERMAGQMPSTKGCL 197 R A +PSTKG L Sbjct: 182 PRRADAIPSTKGML 195 Lambda K H 0.325 0.141 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 197 Length of database: 195 Length adjustment: 20 Effective length of query: 177 Effective length of database: 175 Effective search space: 30975 Effective search space used: 30975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 16 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory