Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate WP_011840556.1 RSPH17029_RS03625 indole-3-glycerol phosphate synthase TrpC
Query= BRENDA::P00909 (453 letters) >NCBI__GCF_000015985.1:WP_011840556.1 Length = 270 Score = 157 bits (396), Expect = 5e-43 Identities = 101/260 (38%), Positives = 151/260 (58%), Gaps = 7/260 (2%) Query: 2 MQTVLAKIVADKAIWVEARKQQQPLASFQNEVQ--PSTRHFYDALQGARTA---FILECK 56 M T+L +I A K + ARK ++PL + ++ + P+ R F AL A I E K Sbjct: 1 MSTILDRIKAYKLEEIAARKAERPLVAVEDAARAAPAPRGFARALSTAAATGYGLIAEIK 60 Query: 57 KASPSKGVIRDDFDPARIAAIYKHY-ASAISVLTDEKYFQGSFNFLPIVSQIAPQPILCK 115 KASPSKG+IR+DFD +A Y+ A+ +SVLTD FQG+ +FL + P L K Sbjct: 61 KASPSKGLIREDFDVPALARAYETGGATCLSVLTDGPSFQGADDFLRQAREAVKLPCLRK 120 Query: 116 DFIIDPYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGVLTEVSNEEEQERAI 175 DF+ D YQ+ AR AD L++++ + D Q +L A A M VL EV + +E RA Sbjct: 121 DFLYDTYQVAEARALGADCILIIMASVTDSQALELEAAASHWGMDVLVEVHSRDELARAE 180 Query: 176 ALGAKVVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHF-ANGF 234 L ++++GINNR+L + L+ TR+LA ++ + ++SESG+ T + +L+ + A F Sbjct: 181 HLKSRLIGINNRNLDTFEVSLDVTRDLARRVPEDRLIVSESGLYTPEDLADLARYGARCF 240 Query: 235 LIGSALMAHDDLHAAVRRVL 254 LIG +LM D+ AA R +L Sbjct: 241 LIGESLMRQADVEAATRAIL 260 Lambda K H 0.320 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 453 Length of database: 270 Length adjustment: 29 Effective length of query: 424 Effective length of database: 241 Effective search space: 102184 Effective search space used: 102184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 16 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory