Align Shikimate kinase; SK; EC 2.7.1.71 (uncharacterized)
to candidate WP_011841527.1 RSPH17029_RS11245 adenylate kinase
Query= curated2:Q9KXQ5 (171 letters) >NCBI__GCF_000015985.1:WP_011841527.1 Length = 229 Score = 34.7 bits (78), Expect = 1e-06 Identities = 35/122 (28%), Positives = 51/122 (41%), Gaps = 23/122 (18%) Query: 4 PLIVLVGPMGVGKSTVGQLLAERLGTGYRDTDEDIVTAQGRAIAEIFVDEGEAAFRTLE- 62 P+++L+GP G GK T ++L ER G T + + RA G AA +E Sbjct: 12 PVLILLGPPGAGKGTQARMLEERFGLVQLSTGDLL-----RAAVAAGTPAGMAAKAVMEA 66 Query: 63 -----KEAVRTALAEHEGVLALGGGAILDADTRAL-----------LAGQRV-VYLSMDV 105 E V LA+ + G ILD R AGQRV +S++V Sbjct: 67 GGLVSDEIVLAILADRMAQPDVARGIILDGFPRTAGQAAALDGLLERAGQRVTAAISLEV 126 Query: 106 EE 107 ++ Sbjct: 127 DD 128 Lambda K H 0.316 0.132 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 171 Length of database: 229 Length adjustment: 20 Effective length of query: 151 Effective length of database: 209 Effective search space: 31559 Effective search space used: 31559 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 16 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory