Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate WP_011842049.1 RSPH17029_RS15385 dihydrodipicolinate synthase family protein
Query= BRENDA::Q7D3Z9 (297 letters) >NCBI__GCF_000015985.1:WP_011842049.1 Length = 294 Score = 404 bits (1039), Expect = e-117 Identities = 198/292 (67%), Positives = 231/292 (79%) Query: 1 MTKKAFVAIVTCFNDDETINYEATRAQVRRQVTAGNNIMCAGTNGDFTALTHSEKIRILE 60 MT+ A VA+VTCF++DET+NY ATRAQVRRQ+ AGN++M GTNGDF+ALTH EKIR++ Sbjct: 1 MTRNAHVALVTCFHEDETVNYAATRAQVRRQLAAGNDLMVCGTNGDFSALTHDEKIRLVG 60 Query: 61 EVVDEVGGKVDVIVNAGMPATFETLQLAKEFDRIGVKGIAVITPFFIACTQDGLIRHFST 120 EV++EV G+ VI N G PATFETLQLA+ D +G+ GIAVI P+FI+CTQDGLIRHFST Sbjct: 61 EVMEEVAGRAKVIANVGCPATFETLQLARAVDGMGLHGIAVIAPYFISCTQDGLIRHFST 120 Query: 121 VADEVNTPVYLYDIPARTQNHIEPETARKLATHGNIAGIKDSGGAQETLEAYLQVSKEVD 180 VAD V TPVYLYDIPARTQNHIEP T LA HGNIAGIKDSGGA +T+ AYL V+++VD Sbjct: 121 VADAVTTPVYLYDIPARTQNHIEPATVGTLARHGNIAGIKDSGGATDTVRAYLDVARDVD 180 Query: 181 GFEVYSGPDHLVLWALQNGAAGCISGLGNAMPDVLAGIVNGFNSGDITYAERQQSVYTAF 240 GFEVY PDHLVLW L+ G AG +SGLGN P +LA I+ GFN+GD+ A Q + Sbjct: 181 GFEVYCAPDHLVLWGLEEGCAGVVSGLGNVAPGLLAQIIAGFNAGDMEAARAAQENFAGL 240 Query: 241 RTDLYAHGFPPAMVKRALYLQDPSVGASRQPALLPDAEQDQKIEEILRKYGL 292 R DLYA GFPPA+VKRALYL DPSVG SRQPALLPDA QD +I IL GL Sbjct: 241 RKDLYALGFPPALVKRALYLNDPSVGLSRQPALLPDAAQDAQILAILTARGL 292 Lambda K H 0.318 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 297 Length of database: 294 Length adjustment: 26 Effective length of query: 271 Effective length of database: 268 Effective search space: 72628 Effective search space used: 72628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 16 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory