Align N-(5'-phosphoribosyl)anthranilate isomerase; Short=PRAI; EC 5.3.1.24 (characterized, see rationale)
to candidate WP_011842227.1 RSPH17029_RS16470 phosphoribosylanthranilate isomerase
Query= uniprot:TRPF_RHIME (215 letters) >NCBI__GCF_000015985.1:WP_011842227.1 Length = 212 Score = 208 bits (529), Expect = 7e-59 Identities = 108/207 (52%), Positives = 141/207 (68%) Query: 5 VKICGLKTAEAVERAVALGASHVGFIFFPKSPRNIEPDDAGRLAARARGRAKIVAVTVDA 64 VKICGL+T V+ A + GA++VG +FFPKSPR++E A RLA A VA+TVDA Sbjct: 6 VKICGLRTESDVKAAASSGAAYVGLVFFPKSPRHLELAQAQRLALAAPPGVAKVALTVDA 65 Query: 65 DNDGLDEIVSALDPDVLQLHGSETPERVLSIKALYGLPVMKALAVREASDLERIDPYLGI 124 ++ LD IV A+ D+LQLHG E+PERV ++A YGLPVMKA+ V + DL +I Sbjct: 66 SDETLDAIVEAVPLDMLQLHGGESPERVAEVRARYGLPVMKAVGVADEGDLPQILEQSLA 125 Query: 125 VDRFLLDAKPPAGSDLPGGNGISFDWRLLDALDGSVDYMLSGGLNAGNIADALALTGARA 184 D+ L+DAKPP G+ LPGGNG+SFDWRL+ +ML+GGL A N+A+A+ TGA Sbjct: 126 ADQILIDAKPPKGAALPGGNGLSFDWRLISGRHWIRPWMLAGGLTAENLAEAVRRTGASQ 185 Query: 185 IDTSSGVESAPGIKDLTLMEAFFEAVR 211 +D SSGVESAPG+KD + AF + R Sbjct: 186 VDVSSGVESAPGVKDPARIAAFLQTAR 212 Lambda K H 0.318 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 215 Length of database: 212 Length adjustment: 22 Effective length of query: 193 Effective length of database: 190 Effective search space: 36670 Effective search space used: 36670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 16 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory