Align Serine acetyltransferase; SAT; EC 2.3.1.30 (characterized)
to candidate WP_011842568.1 RSPH17029_RS18635 N-acetyltransferase
Query= SwissProt::Q06750 (217 letters) >NCBI__GCF_000015985.1:WP_011842568.1 Length = 174 Score = 58.2 bits (139), Expect = 9e-14 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 12/125 (9%) Query: 57 ISQVSRFFTGIEIHPGATIGRRFFID-HGM---GVVIGETCEIGNNVTVFQGVTLGGT-- 110 I +R +EI G T+G R I H GV + + +G+ V + T Sbjct: 27 IGSETRIGPFVEIQGGCTVGARCKISSHSFLCEGVTLEDEVFVGHGVMFTNDIFPESTNP 86 Query: 111 ------GKEKGKRHPTIKDDALIATGAKVLGSITVGEGSKIGAGSVVLHDVPDFSTVVGI 164 G + ++ A + + A +LG +T+G G+ +GAG+VV DVPD + VVG+ Sbjct: 87 DGSLKSGDDWSCEAVLVRRGASLGSNATILGGVTIGAGALVGAGAVVTRDVPDHAIVVGV 146 Query: 165 PGRVV 169 P RV+ Sbjct: 147 PARVI 151 Lambda K H 0.323 0.141 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 217 Length of database: 174 Length adjustment: 20 Effective length of query: 197 Effective length of database: 154 Effective search space: 30338 Effective search space used: 30338 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 16 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory