Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate WP_012743758.1 EUBREC_RS13495 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_000020605.1:WP_012743758.1 Length = 392 Score = 157 bits (397), Expect = 5e-43 Identities = 112/357 (31%), Positives = 173/357 (48%), Gaps = 14/357 (3%) Query: 32 DLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQRRHGITVEP 91 D ++L G+P P +R +L + Y+ G+ EL+ IA RR+G+T + Sbjct: 29 DAISLGVGEPDFDTPWHIRDEGIYSLEKGRTFYTSNAGLKELKIEIAKYLDRRYGMTYDY 88 Query: 92 DA-VVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRF 150 + +++T G S +A A DAGD V + P Y Y G V + + F Sbjct: 89 NKEIMVTVGGSEAIDIALRAMLDAGDEVIIPQPSYVSYVPCTVLAGGTPVIVELKEENDF 148 Query: 151 QPTAQML-AEIDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLV 209 + TA+ L A I P + +++ P NPTG ++ +L AI D+ +ISDE+Y L Sbjct: 149 RLTAEELEAVITPKTKILIMPFPNNPTGAIMEKADLEAIVQVVKEHDLFVISDEIYSELT 208 Query: 210 YQGAPQTSCAWQTSRN-AVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFTICPP 268 Y + ++ + V++N FSK YAMTGWRLG+ P + + + + +C P Sbjct: 209 YVDKHVSIASFPGMKERTVLINGFSKAYAMTGWRLGYACAPETILKQMLKIHQFAIMCAP 268 Query: 269 VLSQIAAVSAFTPEATAEADGNLA----SYAINRSLLLDGLRRIGIDRLAPTDGAFYVYA 324 SQ AAV EA D ++A Y R +L + +G+ P GAFY + Sbjct: 269 TTSQYAAV-----EAMKNGDEDVAQMREEYNGRRRYVLHRFKEMGLKCFEPF-GAFYAFP 322 Query: 325 DVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTARGGSFVRISFAGPSGDIEEALRRI 381 + +F +S F +KLL +A+ PG F G F+RIS+A D++EAL RI Sbjct: 323 SIKEFGMNSDEFATKLLNSKKIAVVPGTAFGEC-GEGFLRISYAYSLDDLKEALGRI 378 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 392 Length adjustment: 31 Effective length of query: 357 Effective length of database: 361 Effective search space: 128877 Effective search space used: 128877 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 13 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory