Align Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 (characterized)
to candidate 7022788 Shewana3_0043 shikimate 5-dehydrogenase (RefSeq)
Query= SwissProt::Q9KVT3 (278 letters) >FitnessBrowser__ANA3:7022788 Length = 292 Score = 287 bits (734), Expect = 2e-82 Identities = 147/277 (53%), Positives = 187/277 (67%), Gaps = 6/277 (2%) Query: 5 IDQYAVFGNPINHSKSPFIHTLFARQTQQSMIYTAQCVPVDGFTEAAKHFFAQGGRGCNV 64 +D+YAVFGNPI HSKSPFIH FA TQQ++ Y A P+DGF + + FF GG+G NV Sbjct: 12 LDRYAVFGNPIGHSKSPFIHGQFASLTQQTLSYEAILAPIDGFEASLRAFFQAGGKGANV 71 Query: 65 TVPFKEEAYRFADRLTERARLAGAVNTLKKLDDGEILGDNTDGEGLVQDLLAQQVLLKGA 124 TVPFKE+A+ D L+ A LAGAVNTL L DG I GDNTDG GLV DL+ L+ Sbjct: 72 TVPFKEQAFALCDSLSAEATLAGAVNTLSLLADGTIYGDNTDGLGLVADLVRHLGSLQHK 131 Query: 125 TILLIGAGGAARGVLKPLLDQQPASITVTNRTFAKAEQLAELVAAYGE------VKAQAF 178 +LL+GAGGAARG + PLL + + +TNRT +KA+ L ++ + E ++A + Sbjct: 132 RVLLVGAGGAARGCILPLLKAEVGQLVITNRTQSKAQALVDIFSQVQEGRYSDKLQAVSM 191 Query: 179 EQLKQSYDVIINSTSASLDGELPAIDPVIFSSRSVCYDMMYGKGYTVFNQWARQHGCAQA 238 +L +D++INSTSASL GELP + I +++ CYDMMYG T FNQWA Q G AQ Sbjct: 192 SELSGVFDLVINSTSASLAGELPPLSQSIIGNKTACYDMMYGAKPTAFNQWALQQGAAQV 251 Query: 239 IDGLGMLVGQAAESFMLWRGLRPGTKQILRELRKNLE 275 IDGLGMLVGQAA+SF LWRG+ P T +L+ LR L+ Sbjct: 252 IDGLGMLVGQAAKSFALWRGVEPDTSGVLKLLRDKLQ 288 Lambda K H 0.320 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 292 Length adjustment: 26 Effective length of query: 252 Effective length of database: 266 Effective search space: 67032 Effective search space used: 67032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate 7022788 Shewana3_0043 (shikimate 5-dehydrogenase (RefSeq))
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.30632.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-88 282.6 0.0 1.6e-88 282.4 0.0 1.0 1 lcl|FitnessBrowser__ANA3:7022788 Shewana3_0043 shikimate 5-dehydr Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__ANA3:7022788 Shewana3_0043 shikimate 5-dehydrogenase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 282.4 0.0 1.6e-88 1.6e-88 3 269 .. 15 287 .. 13 288 .. 0.96 Alignments for each domain: == domain 1 score: 282.4 bits; conditional E-value: 1.6e-88 TIGR00507 3 lgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlellDeieesak 79 ++v+Gnpi hSksp+ih ++++ ++++l Y a+ ++i+ +e l +++++g kG+nvTvPfKe++++l+D ++ +a lcl|FitnessBrowser__ANA3:7022788 15 YAVFGNPIGHSKSPFIHGQFASLTQQTLSYEAILAPIDGFEASLRAFFQAGGKGANVTVPFKEQAFALCDSLSAEAT 91 9**************************************************************************** PP TIGR00507 80 ligavNTlk.ledgklvgynTDgiGlvssLek.lsklksekrvliiGAGGaakavaleLlka.dkeviiaNRtveka 153 l+gavNTl l dg ++g+nTDg+Glv++L + l l+ +krvl++GAGGaa++ +l+Llka +++i+NRt++ka lcl|FitnessBrowser__ANA3:7022788 92 LAGAVNTLSlLADGTIYGDNTDGLGLVADLVRhLGSLQ-HKRVLLVGAGGAARGCILPLLKAeVGQLVITNRTQSKA 167 *********99*********************9*****.**********************95579*********** PP TIGR00507 154 eelaerlqe......lgeilalsleevelkkvdliinatsaglsgeideaevkaellkegklvvDlvynpletpllk 224 ++l++ + + + +a+s++e+ +dl+in+tsa+l ge+ ++++++++ ++++++D++y + t++ + lcl|FitnessBrowser__ANA3:7022788 168 QALVDIFSQvqegrySDKLQAVSMSELSG-VFDLVINSTSASLAGEL--PPLSQSIIGNKTACYDMMYGAKPTAFNQ 241 *******9977777666778888887754.4****************..**************************** PP TIGR00507 225 eakkkg.tkvidGlgMlvaQaalsFelwtgvepdvekvfealkekl 269 +a ++g ++vidGlgMlv Qaa+sF lw+gvepd + v + l++kl lcl|FitnessBrowser__ANA3:7022788 242 WALQQGaAQVIDGLGMLVGQAAKSFALWRGVEPDTSGVLKLLRDKL 287 ******99******************************99999988 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (292 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.91 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory