Align 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 (characterized)
to candidate BPHYT_RS17885 BPHYT_RS17885 3-dehydroquinate synthase
Query= SwissProt::U3KRF2 (445 letters) >FitnessBrowser__BFirm:BPHYT_RS17885 Length = 361 Score = 380 bits (975), Expect = e-110 Identities = 193/335 (57%), Positives = 242/335 (72%), Gaps = 3/335 (0%) Query: 84 VDVDLGDRSYPIYIGSGLLDQPDLLQRHVHGKRVLVVTNSTVAPIYLDKVVGALTNGNPN 143 V+V+LG+R+YPI+IG+ L+ Q L H+ G V +VTNSTV P+Y DK+ AL Sbjct: 7 VNVELGERAYPIHIGTDLIGQTALFAPHIAGSSVTIVTNSTVDPLYGDKLRAALAPLGKQ 66 Query: 144 VSVESVILPDGEKYKNMDTLMKVFDKAIESRLDRRCTFVALGGGVIGDMCGYAAASFLRG 203 VS +V+LPDGE YKN++TL +FD + R DR+ T +ALGGGVIGDM G+AAA ++RG Sbjct: 67 VS--TVVLPDGEAYKNLETLNLIFDALLGGRADRKTTLIALGGGVIGDMTGFAAACYMRG 124 Query: 204 VNFIQIPTTVMAQVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASG 263 V FIQ+PTT+++QVDSSVGGKTGINH LGKN+IGAFYQPQ V+ D L TLP RELA+G Sbjct: 125 VPFIQVPTTLLSQVDSSVGGKTGINHPLGKNMIGAFYQPQAVIADIGALRTLPPRELAAG 184 Query: 264 LAEVVKYGLIRDANFFEWQEKNMPALMARDPSALAYAIKRSCENKAEVVSLDEKESGLRA 323 +AEV+K G I DA FF W E N+ AL +P ALA A+KRSCE KA VV+ DE+E GLRA Sbjct: 185 IAEVIKTGAIADAGFFRWIETNIEALNRCEPEALAEAVKRSCEIKASVVAQDEREGGLRA 244 Query: 324 TLNLGHTFGHAIETGFGYGQWLHGEAVAAGMVMAVDMSYRLGWIDESIVNRAHNILQQAK 383 LN GHTFGHAIE G GYG+WLHGEAV GMVMA D+S RLG++DE+ R +++ A Sbjct: 245 ILNFGHTFGHAIEAGLGYGEWLHGEAVGCGMVMAADLSVRLGYLDEAARKRLVDVIVAAH 304 Query: 384 LPTAPPETMTVEMFKSVMAVDKKVADGLLRLILLK 418 LPT P + + +M VDKK G ++ ILLK Sbjct: 305 LPTRAP-ALGDSRYVELMRVDKKAEAGAIKFILLK 338 Lambda K H 0.318 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 361 Length adjustment: 31 Effective length of query: 414 Effective length of database: 330 Effective search space: 136620 Effective search space used: 136620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate BPHYT_RS17885 BPHYT_RS17885 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.17454.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-123 397.5 0.0 3.1e-123 397.3 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS17885 BPHYT_RS17885 3-dehydroquinate s Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS17885 BPHYT_RS17885 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 397.3 0.0 3.1e-123 3.1e-123 1 340 [. 16 354 .. 16 358 .. 0.96 Alignments for each domain: == domain 1 score: 397.3 bits; conditional E-value: 3.1e-123 TIGR01357 1 ykvkvgegllkklveelae.kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletva 69 y++++g++l+ +++ + s++ ++t+++v+ l+++kl++al+ lg +v ++v+pdge +K+let++ lcl|FitnessBrowser__BFirm:BPHYT_RS17885 16 YPIHIGTDLIGQTALFAPHiAGSSVTIVTNSTVDPLYGDKLRAALAPLGKQVSTVVLPDGEAYKNLETLN 85 6899****999776665554559*********************************************** PP TIGR01357 70 klldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgkN 139 + d+ll ++rk++l+a+GGGv+gD++GF+Aa y+RG++++qvPTtll++vDssvGGKtgin+plgkN lcl|FitnessBrowser__BFirm:BPHYT_RS17885 86 LIFDALLGGRADRKTTLIALGGGVIGDMTGFAAACYMRGVPFIQVPTTLLSQVDSSVGGKTGINHPLGKN 155 ********************************************************************** PP TIGR01357 140 liGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeelikr 209 +iGafyqP+aV+ d+ l+tlp rel++G+aEviK+g+iada +f+++e+n ++l++ +e eal+e++kr lcl|FitnessBrowser__BFirm:BPHYT_RS17885 156 MIGAFYQPQAVIADIGALRTLPPRELAAGIAEVIKTGAIADAGFFRWIETNIEALNR-CEPEALAEAVKR 224 ****************************************************98876.788********* PP TIGR01357 210 sievKaevVeeDekesglRalLNfGHtlgHaiEallkyk.lsHGeaVaiGmvveaklseklgllkaelle 278 s+e+Ka+vV++De+e glRa+LNfGHt+gHaiEa l+y+ + HGeaV +Gmv++a ls +lg+l++ ++ lcl|FitnessBrowser__BFirm:BPHYT_RS17885 225 SCEIKASVVAQDEREGGLRAILNFGHTFGHAIEAGLGYGeWLHGEAVGCGMVMAADLSVRLGYLDEAARK 294 ********************************************************************** PP TIGR01357 279 rlvallkklglptklkkklsveellkallkDKKnegskiklvlleeiGkaalasevteeell 340 rlv+++ +++lpt+ + l + +++ + DKK+e++ ik++ll+++G++ ++ + ++ e++ lcl|FitnessBrowser__BFirm:BPHYT_RS17885 295 RLVDVIVAAHLPTRAPA-LGDSRYVELMRVDKKAEAGAIKFILLKRFGETLIT-QAPDAEVH 354 ****************7.9999***************************9999.77666665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (361 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.16 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory