Align chorismate synthase (EC 4.2.3.5) (characterized)
to candidate 351612 BT2084 chorismate synthase (NCBI ptt file)
Query= BRENDA::B5AAU3 (442 letters) >FitnessBrowser__Btheta:351612 Length = 358 Score = 365 bits (936), Expect = e-105 Identities = 188/351 (53%), Positives = 240/351 (68%), Gaps = 5/351 (1%) Query: 56 NIFGDYFQVATYGESHGGGVGCVISGCPPRIPLTEEDMQGDLDRRRPGQSRITTPRKETD 115 N FG+ F++ ++GESHG GVG VI G P I + EE +Q +L+RRRPGQS +TTPRKE D Sbjct: 3 NSFGNIFRLTSFGESHGKGVGGVIDGFPSGITIDEEFVQQELNRRRPGQSILTTPRKEAD 62 Query: 116 TCKILSGTYEGMTTGTPIHVFVPNTDQRGGDYTEMAKAYRPSHADLTYDLKYGVRSVQGG 175 + LSG +EG +TG PI V N +Q DY + + YRPSHAD TY +KYG+R +GG Sbjct: 63 KVEFLSGIFEGKSTGCPIGFIVWNENQHSNDYNNLKEVYRPSHADYTYKVKYGIRDHRGG 122 Query: 176 GRSSARETIGRVAAGAVAKKILKLKCGVEILAFVSKVHQVVLPEDAVDYETLTLDQIESN 235 GRSSARETI RV AGA+AK L+ + G+ I A+ S+V + L DY+ LD IE+N Sbjct: 123 GRSSARETISRVVAGALAKLALR-QLGISITAYTSQVGAIKLEGTYSDYD---LDLIETN 178 Query: 236 ICRCPDPEYAQKMIDAIDKVRINGNSIGGVVTCIARNVPRGLGSPVFDKLEALLAKAMLS 295 RCPDPE A++M D I KV+ G++IGG +TC+ + P GLG PVF KL A L AMLS Sbjct: 179 DVRCPDPEKAKEMADLIYKVKGEGDTIGGTLTCVIKGCPIGLGQPVFGKLHAALGNAMLS 238 Query: 296 LPASKGFEIGSGFAGTDLTGSEHNDEFYMDEGGNVRTRTNRSGGVQGGISNGETIYFKVA 355 + A+K FE G GF G + GSE ND F+ + G + T TN SGG+QGGISNG+ IYF+V Sbjct: 239 INAAKAFEYGEGFKGLKMKGSEQNDVFF-NNNGRIETHTNHSGGIQGGISNGQDIYFRVV 297 Query: 356 FKPTATIGKKQNTVTRDHEDIELLTRGRHDPCVVPRAVPMVETMAALVLMD 406 FKP AT+ +Q TV D D L RGRHD CV+PRAVP+VE MAA+ ++D Sbjct: 298 FKPIATLLMEQETVNIDGVDTTLKARGRHDACVLPRAVPIVEAMAAMTILD 348 Lambda K H 0.317 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 358 Length adjustment: 31 Effective length of query: 411 Effective length of database: 327 Effective search space: 134397 Effective search space used: 134397 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 351612 BT2084 (chorismate synthase (NCBI ptt file))
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.20898.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-140 453.2 0.1 3.1e-140 453.0 0.1 1.0 1 lcl|FitnessBrowser__Btheta:351612 BT2084 chorismate synthase (NCBI Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:351612 BT2084 chorismate synthase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 453.0 0.1 3.1e-140 3.1e-140 1 348 [. 9 354 .. 9 357 .. 0.98 Alignments for each domain: == domain 1 score: 453.0 bits; conditional E-value: 3.1e-140 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtGaPialli 76 +rlt fGeSHgk +g +idG+P+g++++ee +q+el+rRrpgqs+lt++rkE+D+ve+lsG+feGk tG Pi +++ lcl|FitnessBrowser__Btheta:351612 9 FRLTSFGESHGKGVGGVIDGFPSGITIDEEFVQQELNRRRPGQSILTTPRKEADKVEFLSGIFEGKSTGCPIGFIV 84 89************************************************************************** PP TIGR00033 77 kNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLketagieivayvvklg 152 N++++s+dy+++ke++RP+Hadyty +KYgi+d++gggrsSaReT+ rv+aGa+ak L++ gi i+ay++++g lcl|FitnessBrowser__Btheta:351612 85 WNENQHSNDYNNLKEVYRPSHADYTYKVKYGIRDHRGGGRSSARETISRVVAGALAKLALRQ-LGISITAYTSQVG 159 **************************************************************.88*********** PP TIGR00033 153 eveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvvsnvpvglGeplfdkldaelas 228 ++le ++ + + + ++++ vrcpd+e++kem ++i k+k +gd++Gg +++v+++ p glG+p+f kl+a+l++ lcl|FitnessBrowser__Btheta:351612 160 AIKLEGTYSD-YDLDLIETNDVRCPDPEKAKEMADLIYKVKGEGDTIGGTLTCVIKGCPIGLGQPVFGKLHAALGN 234 *****97776.68999************************************************************ PP TIGR00033 229 allsinAvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGieGGitnGedirvriavKpiptikkplkt 304 a+lsinA+K++e G+GF+ +++Gse nD + ++++i+++tn+sGGi+GGi+nG+di++r+++Kpi+t+ +++t lcl|FitnessBrowser__Btheta:351612 235 AMLSINAAKAFEYGEGFKGLKMKGSEQNDVFFNNNGRIETHTNHSGGIQGGISNGQDIYFRVVFKPIATLLMEQET 310 **************************************************************************** PP TIGR00033 305 vdletkekakatkgRhDpcvvpravpvvEamvalvladallekr 348 v++++ +++ ++gRhD cv+pravp+vEam a++++d +l ++ lcl|FitnessBrowser__Btheta:351612 311 VNIDGVDTTLKARGRHDACVLPRAVPIVEAMAAMTILDYYLLDK 354 **************************************988655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (358 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.36 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory