Align imidazole glycerol-phosphate synthase (subunit 2/2) (EC 4.3.2.10) (characterized)
to candidate 350906 BT1378 imidazole glycerol phosphate synthase subunit hisF (NCBI ptt file)
Query= BRENDA::Q9X0C6 (253 letters) >FitnessBrowser__Btheta:350906 Length = 251 Score = 276 bits (706), Expect = 3e-79 Identities = 142/250 (56%), Positives = 179/250 (71%), Gaps = 1/250 (0%) Query: 1 MLAKRIIACLDVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRK 60 MLAKRII CLD+KDG+ VKGTNF NLR +GDPVELG+ YSE G DELVFLDITAS E RK Sbjct: 1 MLAKRIIPCLDIKDGQTVKGTNFVNLRQAGDPVELGRAYSEQGADELVFLDITASHEGRK 60 Query: 61 TMLELVEKVAEQIDIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTF 120 T ELV+++A I+IPFTVGGGI++ L+ GADK+SIN++A+ NP LI IA+ F Sbjct: 61 TFTELVKRIAANINIPFTVGGGINELSDVDRLLNAGADKISINSSAIRNPQLIDDIAKNF 120 Query: 121 GSQAVVVAIDAKRVDGEFMVFTYSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKS 180 GSQ V+A+DAK+ + + + G+ T L W E ++RGAGEIL TS++ DG K+ Sbjct: 121 GSQVCVLAVDAKQTENGWKCYLNGGRIETDKELLAWTKEAQERGAGEILFTSMNHDGVKT 180 Query: 181 GYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAG-ADAALAASVFHFREIDVRELKE 239 GY E + + ++P+IASGGAG EHF +AFL G ADAALAASVFHF EI + ELK Sbjct: 181 GYANEALASLADQLSIPVIASGGAGLKEHFRDAFLVGKADAALAASVFHFGEIKIPELKS 240 Query: 240 YLKKHGVNVR 249 YL G+ +R Sbjct: 241 YLCGEGITIR 250 Lambda K H 0.320 0.138 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 253 Length of database: 251 Length adjustment: 24 Effective length of query: 229 Effective length of database: 227 Effective search space: 51983 Effective search space used: 51983 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
Align candidate 350906 BT1378 (imidazole glycerol phosphate synthase subunit hisF (NCBI ptt file))
to HMM TIGR00735 (hisF: imidazoleglycerol phosphate synthase, cyclase subunit)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00735.hmm # target sequence database: /tmp/gapView.1373.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00735 [M=254] Accession: TIGR00735 Description: hisF: imidazoleglycerol phosphate synthase, cyclase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-111 356.4 0.1 4.2e-111 356.2 0.1 1.0 1 lcl|FitnessBrowser__Btheta:350906 BT1378 imidazole glycerol phosph Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:350906 BT1378 imidazole glycerol phosphate synthase subunit hisF (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 356.2 0.1 4.2e-111 4.2e-111 1 254 [] 1 250 [. 1 250 [. 0.99 Alignments for each domain: == domain 1 score: 356.2 bits; conditional E-value: 4.2e-111 TIGR00735 1 mlakriipCLdvkdgrvvkGvqfknlrdaGdpvelakkydeeGadelvflditassekretmlevvervaekvfiP 76 mlakriipCLd+kdg+ vkG++f nlr+aGdpvel ++y+e+Gadelvflditas+e+r+t +e+v+r+a ++ iP lcl|FitnessBrowser__Btheta:350906 1 MLAKRIIPCLDIKDGQTVKGTNFVNLRQAGDPVELGRAYSEQGADELVFLDITASHEGRKTFTELVKRIAANINIP 76 8*************************************************************************** PP TIGR00735 77 ltvgGGiksiedvkkllraGadkvsintaavkapelikeladrfGsqaivvaidakreaeneeakyevtikgGres 152 +tvgGGi++++dv++ll+aGadk+sin++a+++p+li ++a+ fGsq++v+a+dak++++ ++++ +gGr + lcl|FitnessBrowser__Btheta:350906 77 FTVGGGINELSDVDRLLNAGADKISINSSAIRNPQLIDDIAKNFGSQVCVLAVDAKQTEN----GWKCYLNGGRIE 148 *******************************************************98875....6*********** PP TIGR00735 153 tdldvvewakeveelGaGeilltsmdkdGtksGydlellkkvkeavkiPviasgGaGkaehleeaflkgkadaaLa 228 td ++++w+ke++e+GaGeil+tsm++dG+k+Gy e l +++++++iPviasgGaG +eh+++afl gkadaaLa lcl|FitnessBrowser__Btheta:350906 149 TDKELLAWTKEAQERGAGEILFTSMNHDGVKTGYANEALASLADQLSIPVIASGGAGLKEHFRDAFLVGKADAALA 224 **************************************************************************** PP TIGR00735 229 asvfhkreltieevkeylaergvkvr 254 asvfh++e++i e+k+yl +g+++r lcl|FitnessBrowser__Btheta:350906 225 ASVFHFGEIKIPELKSYLCGEGITIR 250 ************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (254 nodes) Target sequences: 1 (251 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.32 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory