Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate 350061 BT0533 tryptophan synthase beta chain (NCBI ptt file)
Query= uniprot:P50383 (425 letters) >FitnessBrowser__Btheta:350061 Length = 394 Score = 127 bits (320), Expect = 5e-34 Identities = 116/371 (31%), Positives = 173/371 (46%), Gaps = 54/371 (14%) Query: 72 IGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAKEEGIEHVVTET 131 +GRP+PL+ A+RL E K ++Y K E TG+HKIN I Q A+ G + ++ ET Sbjct: 56 VGRPSPLYLARRLSE--KYGCKMYLKREDLNHTGAHKINNTIGQILLARRMGKKRIIAET 113 Query: 132 GAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVY-ASPTNLTEYGRK 190 GAGQ G A A ++ +M+ ++M K E++ + M++ GA V + N+T Sbjct: 114 GAGQHGVATATVCALMDMECIVYMGKTDVERQHINVEKMKMLGATVIPVTSGNMT----- 168 Query: 191 ILETNPQHPGSLGIAMSEAIE--YALKNEFRYLVGSVL------DVVLLHQSVIGQETIT 242 L A +EAI + Y++GS + D+V QSVI +E Sbjct: 169 -----------LKDATNEAIRDWCCHPADTYYIIGSTVGPHPYPDMVARLQSVISEEIKK 217 Query: 243 QL-DLLGED-ADILIGCVGGGSNFGGFTYPFIGNKKGKRYIAVSSAEIPKFSKGEYKYDF 300 QL + G D D LI CVGGGSN G Y +I + G+ I ++ A G + Sbjct: 218 QLMEKEGRDHPDYLIACVGGGSNAAGTIYHYIND--GRVGIILAEA-------GGKGIET 268 Query: 301 PDSAGLLPLVKM--ITLGKDYV---------PPPIYAGGLRYHGVAPTLSLLTKEGIVEW 349 +A + L KM I + YV P + GL Y G+ P + L + Sbjct: 269 GMTAATIQLGKMGIIHGARTYVIQNEDGQIEEPYSISAGLDYPGIGPIHANLAAQRRATV 328 Query: 350 REYNEREIFEAAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERKVIVFNLSGHGLL 409 N+ E EAA + +GI+PA ESAHA+ A++ K V+V +SG G Sbjct: 329 LAVNDDEAIEAAYELTKLEGIIPALESAHAL-----GALKKLKFKPEDVVVLTVSGRGDK 383 Query: 410 DLSNYESMMKR 420 D+ Y S ++ Sbjct: 384 DIETYLSFNEK 394 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 394 Length adjustment: 31 Effective length of query: 394 Effective length of database: 363 Effective search space: 143022 Effective search space used: 143022 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 350061 BT0533 (tryptophan synthase beta chain (NCBI ptt file))
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00263.hmm # target sequence database: /tmp/gapView.10336.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00263 [M=385] Accession: TIGR00263 Description: trpB: tryptophan synthase, beta subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-178 579.4 0.5 2e-178 579.3 0.5 1.0 1 lcl|FitnessBrowser__Btheta:350061 BT0533 tryptophan synthase beta Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:350061 BT0533 tryptophan synthase beta chain (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 579.3 0.5 2e-178 2e-178 1 380 [. 10 387 .. 10 392 .. 0.98 Alignments for each domain: == domain 1 score: 579.3 bits; conditional E-value: 2e-178 TIGR00263 1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskklggakiylkredll 76 g++gefGG+yvpe+l++ +eel+++y + + e+fkke+++ll++y+grp+pl+ a++ls+k+g +k+ylkredl+ lcl|FitnessBrowser__Btheta:350061 10 GYYGEFGGAYVPEILHKCVEELKNTYLGVLESEDFKKEFDQLLRDYVGRPSPLYLARRLSEKYG-CKMYLKREDLN 84 79*************************************************************8.*********** PP TIGR00263 77 htGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymGaedverqklnvfrmellgakvv 152 htGahkinn++gq+lla+r+GkkriiaetGaGqhGvatat++al+++ec vymG++dverq++nv +m++lga+v+ lcl|FitnessBrowser__Btheta:350061 85 HTGAHKINNTIGQILLARRMGKKRIIAETGAGQHGVATATVCALMDMECIVYMGKTDVERQHINVEKMKMLGATVI 160 **************************************************************************** PP TIGR00263 153 pvtsGsktlkdavnealrdWvtsvedthyvlGsavGphPfPeivrefqsvigeevkeqilekegr.lPdaviacvG 227 pvtsG++tlkda+nea+rdW + +dt+y++Gs+vGphP+P++v ++qsvi+ee+k+q++ekegr Pd++iacvG lcl|FitnessBrowser__Btheta:350061 161 PVTSGNMTLKDATNEAIRDWCCHPADTYYIIGSTVGPHPYPDMVARLQSVISEEIKKQLMEKEGRdHPDYLIACVG 236 ***************************************************************6637********* PP TIGR00263 228 GGsnaiGifaafiedeeveligveagGkGidtekhaatlskGkeGvlhGaktkllqdedGqieeahsvsaGldypg 303 GGsna G+ +++i+d +v +i eagGkGi+t ++aat++ Gk G++hGa+t+++q+edGqiee +s+saGldypg lcl|FitnessBrowser__Btheta:350061 237 GGSNAAGTIYHYINDGRVGIILAEAGGKGIETGMTAATIQLGKMGIIHGARTYVIQNEDGQIEEPYSISAGLDYPG 312 **************************************************************************** PP TIGR00263 304 vgPehaalaetgraeyeaitdeealealkllskeeGiipalesshalaaleklapklkkdeivvvnlsGrGdkdle 379 +gP ha+la + ra+ a++d+ea+ea l+k eGiipales+hal al+kl+ k +++vv+++sGrGdkd+e lcl|FitnessBrowser__Btheta:350061 313 IGPIHANLAAQRRATVLAVNDDEAIEAAYELTKLEGIIPALESAHALGALKKLKF--KPEDVVVLTVSGRGDKDIE 386 ****************************************************987..7899**************9 PP TIGR00263 380 t 380 t lcl|FitnessBrowser__Btheta:350061 387 T 387 8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (394 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.77 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory