Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate CCNA_03104 CCNA_03104 3-dehydroquinate synthase
Query= BRENDA::P07639 (362 letters) >FitnessBrowser__Caulo:CCNA_03104 Length = 370 Score = 301 bits (772), Expect = 1e-86 Identities = 171/351 (48%), Positives = 221/351 (62%), Gaps = 7/351 (1%) Query: 4 IVVTLGERSYPITIASGLFNEPASFLPLKSGEQ--VMLVTNETLAPLYLDKVRGVLEQAG 61 + V LGER+Y + I GL ++ + G++ V +VT+ + + +++ L+ AG Sbjct: 5 VPVGLGERAYDVVIGPGLLDQAGERVAAVLGKRKRVAVVTDAHVGAHHGERLSAALQGAG 64 Query: 62 VNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQRG 121 + VD + + GE+ KS L + LL R +VALGGGVVGDL GFAAA Y+RG Sbjct: 65 ITVDLITIAPGEESKSFEGLADLSDRLLALNLERGDQIVALGGGVVGDLAGFAAAIYKRG 124 Query: 122 VRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELASG 181 + F+QVPTTLL+QVDSSVGGKTA++ P GKN+IGAF+QP V+ DLD L TLP RELA G Sbjct: 125 IDFVQVPTTLLAQVDSSVGGKTAIDTPRGKNLIGAFHQPRLVLADLDVLATLPARELACG 184 Query: 182 LAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLRA 241 AE+IKYG++ D AFF WLE N+ A+L D A+ + R E+KAE+VA DE+E G RA Sbjct: 185 YAEIIKYGLLGDFAFFEWLETNVQAVLDRDVDALVRAVGRSVEMKAEIVAEDEKEAGRRA 244 Query: 242 LLNLGHTFGHAIEAEMGYGNWL-HGEAVAAGMVMAARTSERLGQFSSAETQRIITLLKRA 300 LLNLGHTFGHAIEAEMG+G L HGEAV GM A R S RLG S + R +K A Sbjct: 245 LLNLGHTFGHAIEAEMGFGEALKHGEAVGVGMAQAFRFSARLGLCPSQDAVRAQAAIKAA 304 Query: 301 GLPVN----GPREMSAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRSGV 347 GLP P SA A + H +DKK G++ +L IG + V V Sbjct: 305 GLPTTLADVRPEPFSADALIAHCGQDKKAQGGKLTFVLARGIGDAFVAKDV 355 Lambda K H 0.320 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 370 Length adjustment: 30 Effective length of query: 332 Effective length of database: 340 Effective search space: 112880 Effective search space used: 112880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate CCNA_03104 CCNA_03104 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.13198.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-124 402.1 0.0 1.3e-124 401.9 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_03104 CCNA_03104 3-dehydroquinate synt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_03104 CCNA_03104 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 401.9 0.0 1.3e-124 1.3e-124 1 338 [. 14 359 .. 14 364 .. 0.97 Alignments for each domain: == domain 1 score: 401.9 bits; conditional E-value: 1.3e-124 TIGR01357 1 ykvkvgegllkklveelae...kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletvak 70 y+v++g gll+++ e +a k++++ v+td +v ++++e+l++al+ +g++v+ +++ +geesKs+e +a+ lcl|FitnessBrowser__Caulo:CCNA_03104 14 YDVVIGPGLLDQAGERVAAvlgKRKRVAVVTDAHVGAHHGERLSAALQGAGITVDLITIAPGEESKSFEGLAD 86 789*************999886669************************************************ PP TIGR01357 71 lldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgkNliGa 143 l d+ll+ +ler +++va+GGGvvgDlaGF+Aa+y+RGi++vqvPTtlla+vDssvGGKt+i++p+gkNliGa lcl|FitnessBrowser__Caulo:CCNA_03104 87 LSDRLLALNLERGDQIVALGGGVVGDLAGFAAAIYKRGIDFVQVPTTLLAQVDSSVGGKTAIDTPRGKNLIGA 159 ************************************************************************* PP TIGR01357 144 fyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeelikrsievKae 216 f+qP++Vl dl+vl+tlp rel++G+aE+iK+gl+ d ++fe+le+n +++l++ + +al +++ rs+e+Kae lcl|FitnessBrowser__Caulo:CCNA_03104 160 FHQPRLVLADLDVLATLPARELACGYAEIIKYGLLGDFAFFEWLETNVQAVLDR-DVDALVRAVGRSVEMKAE 231 *************************************************99985.77**************** PP TIGR01357 217 vVeeDekesglRalLNfGHtlgHaiEallkyk..lsHGeaVaiGmvveaklseklgllkaellerlvallkkl 287 +V+eDeke+g RalLN+GHt+gHaiEa+++++ l+HGeaV +Gm++++++s +lgl++++++ r +a +k++ lcl|FitnessBrowser__Caulo:CCNA_03104 232 IVAEDEKEAGRRALLNLGHTFGHAIEAEMGFGeaLKHGEAVGVGMAQAFRFSARLGLCPSQDAVRAQAAIKAA 304 ******************************9999*************************************** PP TIGR01357 288 glptklkk....klsveellkallkDKKnegskiklvlleeiGkaalasevteee 338 glpt+l + +s+++l++++ +DKK++g+k+++vl++ iG+a++a++v++ + lcl|FitnessBrowser__Caulo:CCNA_03104 305 GLPTTLADvrpePFSADALIAHCGQDKKAQGGKLTFVLARGIGDAFVAKDVDRAA 359 *******999999***********************************8885544 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (370 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.01 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory