Align shikimate dehydrogenase (EC 1.1.1.25) (characterized)
to candidate Echvi_1145 Echvi_1145 Shikimate 5-dehydrogenase
Query= reanno::Pedo557:CA265_RS19745 (247 letters) >FitnessBrowser__Cola:Echvi_1145 Length = 246 Score = 238 bits (606), Expect = 1e-67 Identities = 128/250 (51%), Positives = 159/250 (63%), Gaps = 8/250 (3%) Query: 1 MKTYGLIGYPLSHSFSKKYFTEKFQNEGIAGHQYELFPIADIKSLPDLLNENPSLCGLNV 60 M+ +GLIGYPL HSFS KYF EKF EGI QY+L+ I I P+L+ NP L G+NV Sbjct: 1 MRKFGLIGYPLKHSFSGKYFAEKFDREGIQDCQYDLYEIDAISKFPELIKNNPGLEGINV 60 Query: 61 TIPHKVNVLCYLNEVDEAAEKIGAVNCISIKSFEGKNYLKGYNTDAYGFEESLKPLLGPQ 120 TIP+K V+ YL+E++ E IGAVNCI IK +N L GYNTD GF+ESL L Q Sbjct: 61 TIPYKEQVIPYLDELEPGCEAIGAVNCIKIK----ENKLIGYNTDYIGFKESLDAWLEGQ 116 Query: 121 HTKALVFGDGGAAKAVKYVLEKLNIQYQLVVRTA--VPGAILYSEV--SPEILASHQLLI 176 KAL+ G GGA+KAVK LE L + Y +V R A G I Y ++ + + L + L++ Sbjct: 117 RPKALILGTGGASKAVKQALEALEMPYLMVSRNANGQKGRITYDDLIKNEQYLQEYFLIV 176 Query: 177 NTTPLGMSPNVDTFPEIDYSLLGPGYLAYDLVYNPLETAFLAKAAERGAAIKNGLEMLYK 236 NTTPLG PN + PEI S +G + YDLVYNP +T + RGA +KNGLEML Sbjct: 177 NTTPLGTFPNTEEMPEIPVSQIGREHKVYDLVYNPEKTFLMRSLEARGAVVKNGLEMLQL 236 Query: 237 QAEKAWAIWN 246 QAE AW IWN Sbjct: 237 QAEAAWKIWN 246 Lambda K H 0.317 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 246 Length adjustment: 24 Effective length of query: 223 Effective length of database: 222 Effective search space: 49506 Effective search space used: 49506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory