Align S-sulfo-L-cysteine synthase (O-acetyl-L-serine-dependent) (EC 2.5.1.144); cysteine synthase (EC 2.5.1.47) (characterized)
to candidate Echvi_0220 Echvi_0220 cysteine synthase B
Query= BRENDA::P29848 (303 letters) >FitnessBrowser__Cola:Echvi_0220 Length = 292 Score = 315 bits (807), Expect = 8e-91 Identities = 159/290 (54%), Positives = 210/290 (72%) Query: 4 LEQTIGNTPLVKLQRLGPDNGSEIWVKLEGNNPAGSVKDRAALSMIVEAEKRGEIKPGDV 63 L + IGNTPLV+L+ + + +I+ KLEG NP GSVKDRAA SMI A RG++K GD Sbjct: 3 LFELIGNTPLVELEHIPTNPNVKIYCKLEGQNPGGSVKDRAAYSMIKRAMDRGDLKQGDR 62 Query: 64 LIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRAAMRAYGAELILVTKEQGMEGAR 123 ++EATSGNTGIALAMIA + G M L+MPDN ++ER +M AYGA++IL + +E +R Sbjct: 63 VVEATSGNTGIALAMIAKVLGVEMTLIMPDNSTRERVVSMEAYGAKVILTPAAKTIEYSR 122 Query: 124 DLALAMSERGEGKLLDQFNNPDNPYAHYTTTGPEIWRQTSGRITHFVSSMGTTGTITGVS 183 LA M++ +L+QF NPDN AHY TGPEI R T+G ITHFVS+MGTTGTI GVS Sbjct: 123 TLAEEMAKNEGYYILNQFANPDNYQAHYEGTGPEIMRDTNGEITHFVSAMGTTGTIMGVS 182 Query: 184 RFLREQEKPVTIVGLQPEEGSSIPGIRRWPAEYMPGIFNASLVDEVLDIHQNDAENTMRE 243 R+L+EQ+ V IVG QP +GSSIPGIRRW E++P I++AS VD+++D+ Q +A R Sbjct: 183 RYLKEQKPAVQIVGTQPTDGSSIPGIRRWSPEFLPKIYDASRVDQIIDVSQEEATEMTRR 242 Query: 244 LAVREGIFCGVSSGGAVAGALRVARATPGAIVVAIICDRGDRYLSTGVFG 293 +A EGI G+SSGGA+ A+++A + ++V I CDRGDRYLS+ +FG Sbjct: 243 MAKEEGILAGMSSGGALHAAVKLAESLDSGVIVCITCDRGDRYLSSDLFG 292 Lambda K H 0.316 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 292 Length adjustment: 26 Effective length of query: 277 Effective length of database: 266 Effective search space: 73682 Effective search space used: 73682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate Echvi_0220 Echvi_0220 (cysteine synthase B)
to HMM TIGR01138 (cysM: cysteine synthase B (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01138.hmm # target sequence database: /tmp/gapView.26888.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01138 [M=290] Accession: TIGR01138 Description: cysM: cysteine synthase B Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-129 415.9 0.1 5.8e-129 415.7 0.1 1.0 1 lcl|FitnessBrowser__Cola:Echvi_0220 Echvi_0220 cysteine synthase B Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_0220 Echvi_0220 cysteine synthase B # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 415.7 0.1 5.8e-129 5.8e-129 3 290 .] 4 291 .. 2 291 .. 0.99 Alignments for each domain: == domain 1 score: 415.7 bits; conditional E-value: 5.8e-129 TIGR01138 3 lklvGntplvrlkrllpeedsevlvklegnnpaGsvkdrpalsmiveaekrGeikeGdvlieatsGntGialam 76 +l+Gntplv l++++++ +++++ kleg+np+Gsvkdr+a smi +a rG++k+Gd ++eatsGntGialam lcl|FitnessBrowser__Cola:Echvi_0220 4 FELIGNTPLVELEHIPTNPNVKIYCKLEGQNPGGSVKDRAAYSMIKRAMDRGDLKQGDRVVEATSGNTGIALAM 77 689*********************************************************************** PP TIGR01138 77 vaalkGykvkllmpdnvseerkaalkayGaelilvdkeeGmeGardlarelvrkgeeklldqfnnpdnpkahyt 150 +a ++G++++l+mpdn+++er ++ayGa++il+ + +e +r la+e++++ +l+qf+npdn++ahy lcl|FitnessBrowser__Cola:Echvi_0220 78 IAKVLGVEMTLIMPDNSTRERVVSMEAYGAKVILTPAAKTIEYSRTLAEEMAKNEGYYILNQFANPDNYQAHYE 151 ****************************************************999999**************** PP TIGR01138 151 stGieiwqqtkGrithfvsslGttGtimGvsrflkeqnpavqivGlqpaegsaieGlrrieseylpgifdaslv 224 tG+ei + t+G ithfvs++GttGtimGvsr+lkeq+pavqivG qp++gs+i+G+rr+ e+lp+i+das+v lcl|FitnessBrowser__Cola:Echvi_0220 152 GTGPEIMRDTNGEITHFVSAMGTTGTIMGVSRYLKEQKPAVQIVGTQPTDGSSIPGIRRWSPEFLPKIYDASRV 225 ************************************************************************** PP TIGR01138 225 drvvdveqedaediarelakkegifvGvssGgavaaalrlarelekavvvaiicdrGdrylstgvf 290 d+++dv qe+a ++ r++ak+egi+ G+ssGga+ aa++la l+ +v+v+i cdrGdryls+ +f lcl|FitnessBrowser__Cola:Echvi_0220 226 DQIIDVSQEEATEMTRRMAKEEGILAGMSSGGALHAAVKLAESLDSGVIVCITCDRGDRYLSSDLF 291 ***************************************************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (290 nodes) Target sequences: 1 (292 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.58 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory