Align 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (EC 5.3.1.16) (characterized)
to candidate Echvi_2515 Echvi_2515 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase
Query= reanno::Cola:Echvi_2515 (239 letters) >FitnessBrowser__Cola:Echvi_2515 Length = 239 Score = 471 bits (1211), Expect = e-138 Identities = 239/239 (100%), Positives = 239/239 (100%) Query: 1 MEIIPAIDIIGGKCVRLTQGDYGQKKEYADNPLEVAKKFEGAGIKRLHLVDLDGAKAKTI 60 MEIIPAIDIIGGKCVRLTQGDYGQKKEYADNPLEVAKKFEGAGIKRLHLVDLDGAKAKTI Sbjct: 1 MEIIPAIDIIGGKCVRLTQGDYGQKKEYADNPLEVAKKFEGAGIKRLHLVDLDGAKAKTI 60 Query: 61 VNRAVLENITSHTSLKVDFGGGVQSDETIQMAFDAGASQVTGGSIAVKNPALFEGWLEKH 120 VNRAVLENITSHTSLKVDFGGGVQSDETIQMAFDAGASQVTGGSIAVKNPALFEGWLEKH Sbjct: 61 VNRAVLENITSHTSLKVDFGGGVQSDETIQMAFDAGASQVTGGSIAVKNPALFEGWLEKH 120 Query: 121 GSEKIILGADAKNRKIAISGWEETTEADVVDFIKDYHAKGARYVICTDVAKDGLLQGPSV 180 GSEKIILGADAKNRKIAISGWEETTEADVVDFIKDYHAKGARYVICTDVAKDGLLQGPSV Sbjct: 121 GSEKIILGADAKNRKIAISGWEETTEADVVDFIKDYHAKGARYVICTDVAKDGLLQGPSV 180 Query: 181 DLYREIIQEIPGIRLIASGGVAEVRDLEVLEKIGVFGTIVGKAFYEGRVSLEELATFAD 239 DLYREIIQEIPGIRLIASGGVAEVRDLEVLEKIGVFGTIVGKAFYEGRVSLEELATFAD Sbjct: 181 DLYREIIQEIPGIRLIASGGVAEVRDLEVLEKIGVFGTIVGKAFYEGRVSLEELATFAD 239 Lambda K H 0.317 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 239 Length of database: 239 Length adjustment: 23 Effective length of query: 216 Effective length of database: 216 Effective search space: 46656 Effective search space used: 46656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
Align candidate Echvi_2515 Echvi_2515 (phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase)
to HMM TIGR00007 (hisA: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (EC 5.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00007.hmm # target sequence database: /tmp/gapView.13250.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00007 [M=231] Accession: TIGR00007 Description: TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-79 250.8 2.7 7.3e-79 250.6 2.7 1.0 1 lcl|FitnessBrowser__Cola:Echvi_2515 Echvi_2515 phosphoribosylformimi Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_2515 Echvi_2515 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomera # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 250.6 2.7 7.3e-79 7.3e-79 1 230 [. 3 233 .. 3 234 .. 0.99 Alignments for each domain: == domain 1 score: 250.6 bits; conditional E-value: 7.3e-79 TIGR00007 1 iiPaiDlkeGkvvrlvqGdkdkktvysddpleaakkfeeegaellHvVDLdgAkegekknlevikkiveelevk 74 iiPaiD++ Gk+vrl+qGd+++k+ y+d+ple+akkfe g+++lH+VDLdgAk++ +n+ v+++i++++++k lcl|FitnessBrowser__Cola:Echvi_2515 3 IIPAIDIIGGKCVRLTQGDYGQKKEYADNPLEVAKKFEGAGIKRLHLVDLDGAKAKTIVNRAVLENITSHTSLK 76 8************************************************************************* PP TIGR00007 75 vqvGGGiRsleavekllelgverviigtaavenpelvkellkelgsekivvslDakegevavkGWkekselslv 148 v+ GGG+ s e+++ ++++g+++v g++av+np+l++ +l++ gseki+++ Dak++++a++GW+e++e+++v lcl|FitnessBrowser__Cola:Echvi_2515 77 VDFGGGVQSDETIQMAFDAGASQVTGGSIAVKNPALFEGWLEKHGSEKIILGADAKNRKIAISGWEETTEADVV 150 ************************************************************************** PP TIGR00007 149 elakkleelgleeiilTdiekdGtlsGvnveltkelvke.aeveviasGGvssiedvkalkklgvkgvivGkAl 221 +++k ++ g++ +i+Td++kdG l+G+ v+l++e+++e + +iasGGv+++ d++ l+k+gv g ivGkA+ lcl|FitnessBrowser__Cola:Echvi_2515 151 DFIKDYHAKGARYVICTDVAKDGLLQGPSVDLYREIIQEiPGIRLIASGGVAEVRDLEVLEKIGVFGTIVGKAF 224 ***************************************9********************************** PP TIGR00007 222 yegklklke 230 yeg+++l+e lcl|FitnessBrowser__Cola:Echvi_2515 225 YEGRVSLEE 233 *****9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (239 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 6.13 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory