Align ribose-phosphate diphosphokinase (EC 2.7.6.1) (characterized)
to candidate Echvi_4597 Echvi_4597 ribose-phosphate pyrophosphokinase
Query= BRENDA::P0A719 (315 letters) >FitnessBrowser__Cola:Echvi_4597 Length = 309 Score = 295 bits (754), Expect = 1e-84 Identities = 158/314 (50%), Positives = 215/314 (68%), Gaps = 7/314 (2%) Query: 1 MPDMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTC 60 MP++KLFAG T +LA IA LG + FSDGE+S +E+VRG +F+IQST Sbjct: 1 MPEVKLFAGTNTKKLADSIAGNYGQDLGAMTLSMFSDGEMSPSFDESVRGCHVFLIQST- 59 Query: 61 APTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSV 120 P DNL+EL +M+DA +RASA ++ AV+PY+GYARQDR+ R RV I AK++A+ + S Sbjct: 60 NPNADNLLELCLMIDAAKRASAYKVCAVVPYYGYARQDRKDRP-RVSIAAKLIANMIMSA 118 Query: 121 GVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNL-DNPIVVSPDIGGVVRARA 179 G DR++T DLHA QIQGFFD+P+D++ GS I + + L+L DN I SPD+GGV RARA Sbjct: 119 GADRIMTCDLHAGQIQGFFDIPLDHLNGSAIFVPYLKSLDLGDNLIFASPDVGGVSRARA 178 Query: 180 IAKLLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKER 239 AK + DM + DK R RAN M +IGDV G+D VLVDD++DT GT+CKAAE L ++ Sbjct: 179 YAKHF-EVDMVVCDKHRKRANEVASMQVIGDVEGKDVVLVDDLVDTAGTMCKAAEILLDK 237 Query: 240 GAKRVFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLSDEIKSLPNVRTLTLSGMLAEA 299 GA V A ATH + SG A N+ NS + E+V+ DTIP+ K ++ LT++ + A+A Sbjct: 238 GANSVRAIATHGVLSGKAYENIENSKLSELVITDTIPIK---KESSKIKVLTVAELFAKA 294 Query: 300 IRRISNEESISAMF 313 I ++ +SISA+F Sbjct: 295 IHAVTGNDSISALF 308 Lambda K H 0.321 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 13 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 309 Length adjustment: 27 Effective length of query: 288 Effective length of database: 282 Effective search space: 81216 Effective search space used: 81216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate Echvi_4597 Echvi_4597 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.3545.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-110 353.7 0.5 3.8e-110 353.6 0.5 1.0 1 lcl|FitnessBrowser__Cola:Echvi_4597 Echvi_4597 ribose-phosphate pyro Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_4597 Echvi_4597 ribose-phosphate pyrophosphokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 353.6 0.5 3.8e-110 3.8e-110 2 308 .. 5 308 .. 4 309 .] 0.98 Alignments for each domain: == domain 1 score: 353.6 bits; conditional E-value: 3.8e-110 TIGR01251 2 kilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmellllidal 75 k+++g+++k+la+++a n g++lg ++ F+dgE++ ++esvrg++vf+i qst p d+l+el l+ida+ lcl|FitnessBrowser__Cola:Echvi_4597 5 KLFAGTNTKKLADSIAGNYGQDLGAMTLSMFSDGEMSPSFDESVRGCHVFLI-QSTN-PNADNLLELCLMIDAA 76 799*************************************************.7777.789************* PP TIGR01251 76 krasaksvtaviPyygYaRqdkkaksrepisaklvaklleeaGadrvltvdlHseqiqgfFdvpvenlsaspkl 149 krasa +v av+PyygYaRqd+k+++r +i+akl+a+++ +aGadr++t dlH+ qiqgfFd+p+++l++s + lcl|FitnessBrowser__Cola:Echvi_4597 77 KRASAYKVCAVVPYYGYARQDRKDRPRVSIAAKLIANMIMSAGADRIMTCDLHAGQIQGFFDIPLDHLNGSAIF 150 ************************************************************************** PP TIGR01251 150 ieelkkke.lknlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnllgdvegkdvvivDDiisT 222 + +lk+ +nl++ sPD G+v+ra+++ak+ ++++++ +K+R+ ++nev +++++gdvegkdvv+vDD+++T lcl|FitnessBrowser__Cola:Echvi_4597 151 VPYLKSLDlGDNLIFASPDVGGVSRARAYAKHFEVDMVVCDKHRK-RANEVASMQVIGDVEGKDVVLVDDLVDT 223 ******99899**********************************.889************************* PP TIGR01251 223 ggTlvkaaelLkekGAkkvivaathgvfsgdAlerlaeagveevivtntilveekklpkvseisvapliaeaia 296 +gT++kaae+L +kGA++v ++athgv+sg+A+e+++++ ++e+++t+ti++ +k+ +k+++++va+l+a+ai lcl|FitnessBrowser__Cola:Echvi_4597 224 AGTMCKAAEILLDKGANSVRAIATHGVLSGKAYENIENSKLSELVITDTIPI-KKESSKIKVLTVAELFAKAIH 296 ****************************************************.8899***************** PP TIGR01251 297 rihenesvsslf 308 +++ n s+s+lf lcl|FitnessBrowser__Cola:Echvi_4597 297 AVTGNDSISALF 308 ***********9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (309 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.70 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory