Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase; EC 2.3.1.89; Tetrahydrodipicolinate N-acetyltransferase; THP acetyltransferase; Tetrahydropicolinate acetylase (uncharacterized)
to candidate Echvi_3679 Echvi_3679 Acetyltransferase (isoleucine patch superfamily)
Query= curated2:Q8TY70 (245 letters) >FitnessBrowser__Cola:Echvi_3679 Length = 189 Score = 66.6 bits (161), Expect = 3e-16 Identities = 51/177 (28%), Positives = 80/177 (45%), Gaps = 20/177 (11%) Query: 66 VVEVLESEDSVEYYHKELDHR-NRAVPLADYSEFEDVRIEPG--AIIREKVKLGKGVVVM 122 V +L + EYY + N P + +D+ +EP + + G+GV + Sbjct: 24 VKRILHKLNVTEYYTDKFQATINELCP----NSAKDLHLEPPFHCDYGQNIHAGEGVFIN 79 Query: 123 MGAVINIGAKIGDGTMVDMNAVVGSRAEVGKNVHIGAGAVIAGVLEP---PSAKPVVIED 179 AVI GAK+ +G + + VHI V E +PV I + Sbjct: 80 FDAVILDGAKV----------TIGRKTLLAPGVHIYTARHPLNVEERREWEDCRPVTIGE 129 Query: 180 DVVIGANAVILEGVRVGKGAVVAAGAVVTEDVPPSKVVAGVPARVVKDVDKKTEAKT 236 + IG + I GV +G AV+ AGAVVT+D+P + G PA+V+K +++K T Sbjct: 130 ECWIGGHVTICPGVTIGDRAVIGAGAVVTKDIPADSLAVGNPAKVIKTLNEKDHKTT 186 Lambda K H 0.315 0.136 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 110 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 245 Length of database: 189 Length adjustment: 22 Effective length of query: 223 Effective length of database: 167 Effective search space: 37241 Effective search space used: 37241 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory