Align Homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.36 (characterized)
to candidate Echvi_2531 Echvi_2531 aconitate hydratase, mitochondrial
Query= SwissProt::Q9ZND9 (163 letters) >FitnessBrowser__Cola:Echvi_2531 Length = 757 Score = 47.8 bits (112), Expect = 4e-10 Identities = 29/73 (39%), Positives = 45/73 (61%), Gaps = 3/73 (4%) Query: 52 ILVFGRNAGLGSSREYAPEALKRLGVRAIIAKSYARIFFRNLVNLGI--VPFESEEVVDA 109 I+V N G GSSRE+A + LGV+A++ KS+ARI NL G+ + F++E D Sbjct: 632 IVVGDHNYGEGSSREHAAMEPRHLGVKAVLVKSFARIHETNLKKQGMLALTFDNEADYDK 691 Query: 110 LEDGDEVE-LDLE 121 +++ D + LDL+ Sbjct: 692 VQEDDTINFLDLD 704 Lambda K H 0.322 0.144 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 757 Length adjustment: 29 Effective length of query: 134 Effective length of database: 728 Effective search space: 97552 Effective search space used: 97552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory