Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate Echvi_2002 Echvi_2002 threonine synthase
Query= BRENDA::P00934 (428 letters) >FitnessBrowser__Cola:Echvi_2002 Length = 430 Score = 344 bits (883), Expect = 3e-99 Identities = 187/410 (45%), Positives = 271/410 (66%), Gaps = 8/410 (1%) Query: 1 MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS 60 MK Y+ + +VS +AV +GL +QGL+ P +P ID++ + F +++ Sbjct: 1 MKFYSTNNKEHKVSLKEAVIKGLAPDQGLYMPERIPTLPADFIDQLPERSFQEIGYEVIG 60 Query: 61 AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH 120 A G+++ +E ++E V AF AP+ VE +V LELFHGPTLAFKDFG RF +++++ Sbjct: 61 AIFGEDLSKEQIKELVDHTLAFDAPLVKVEEEVYTLELFHGPTLAFKDFGARFCSKLMSL 120 Query: 121 IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV 180 + D+ V +L ATSGDTG+AVA+ FY +P V+V+ILYP GK+S LQEK F TLG NI + Sbjct: 121 LVKDEKVRVLVATSGDTGSAVANGFYKVPGVEVIILYPSGKVSTLQEKQFTTLGENITAL 180 Query: 181 AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQ 240 +DG FD CQ +VKQAF D++L ++ L SANSINI+R + Q YYF A ++LP + + Sbjct: 181 EVDGVFDDCQRMVKQAFLDKDLNESMLLTSANSINIARWIPQCLYYFYAYSRLP-KGHEK 239 Query: 241 LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA 300 +V SVPSGNFG++ AG+LA+ +GLP++ F+AATNVN VP FL + P+ + T+SN+ Sbjct: 240 VVFSVPSGNFGNIAAGMLAERMGLPIETFVAATNVNKIVPDFLKGVPFRPRPSLQTISNS 299 Query: 301 MDVSQPNNWPRVEELFRRKIWQLKEL--GYAAVDDETTQQTMRELK-ELGYTSEPHAAVA 357 MDV P+N+ R+ +L+ + +LKE+ G+ DD TT++ M +K GY +PH AVA Sbjct: 300 MDVGNPSNFYRLLDLYGDES-KLKEMVKGF-FFDDATTREAMATVKAAAGYLMDPHGAVA 357 Query: 358 YRALRDQL--NPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERAD 405 Y L+ + +PG G+FL TAHP KF + VEA+ E + LP+ LA D Sbjct: 358 YLGLKAYMEEHPGYTGVFLETAHPGKFGDVVEAVHQEKVTLPERLAAFLD 407 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 428 Length of database: 430 Length adjustment: 32 Effective length of query: 396 Effective length of database: 398 Effective search space: 157608 Effective search space used: 157608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate Echvi_2002 Echvi_2002 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.14223.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-91 292.3 0.0 3.1e-91 292.0 0.0 1.0 1 lcl|FitnessBrowser__Cola:Echvi_2002 Echvi_2002 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_2002 Echvi_2002 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 292.0 0.0 3.1e-91 3.1e-91 16 339 .. 70 399 .. 56 400 .. 0.91 Alignments for each domain: == domain 1 score: 292.0 bits; conditional E-value: 3.1e-91 TIGR00260 16 vdlaegstelfrspklaeevgaenlyvkelfhgPtlaFKDrglqfvavlltkalelgnetvlcAtsGdtgaaaa 89 ++++e + ++++++++ +v++ ++y +elfhgPtlaFKD+g +f ++l++ + ++ + vl+AtsGdtg+a+a lcl|FitnessBrowser__Cola:Echvi_2002 70 EQIKELVDHTLAFDAPLVKVEE-EVYTLELFHGPTLAFKDFGARFCSKLMSLLVKDEKVRVLVATSGDTGSAVA 142 5566777888999999999999.*************************************************** PP TIGR00260 90 ealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDdaqdlvkeifedke...klklnsvNsinp 160 ++++ ++v+v++LyP+gk+s ++ek +t+l en++ l+++G FDd+q++vk++f dk ++l s+Nsin+ lcl|FitnessBrowser__Cola:Echvi_2002 143 NGFYKVPGVEVIILYPSGKVSTLQEKQFTTLGENITALEVDGVFDDCQRMVKQAFLDKDlneSMLLTSANSINI 216 *******************************************************9665566************ PP TIGR00260 161 arieaqktyafeiveqlgkespdkvvvpvpsgnfgailkGflekkelglpieklaiaaegaadivrrflksgdl 234 ar q y+f + +l+ + +kvv++vpsgnfg+i +G l+ +++ lp +++aa++++ iv+ flk+ + lcl|FitnessBrowser__Cola:Echvi_2002 217 ARWIPQCLYYFYAYSRLP-KGHEKVVFSVPSGNFGNIAAGMLAERMG-LP-IETFVAATNVNKIVPDFLKGVPF 287 ******************.999******************8888777.**.56788888888************ PP TIGR00260 235 epkedkeTlstAmdignpsnveralelarrslgnledlkesvsdeeil.eaikklaeeegyllephtavavaal 307 p+ +++T+s++md+gnpsn+ r+l+l + + e +k d++++ ea+ + + gyl++ph+ava+ +l lcl|FitnessBrowser__Cola:Echvi_2002 288 RPRPSLQTISNSMDVGNPSNFYRLLDLYGDESKLKEMVKGFFFDDATTrEAMATVKAAAGYLMDPHGAVAYLGL 361 **************************99999999999998888887762566667777**************** PP TIGR00260 308 kklvekg...vs...atadpaKFeevvealtgnklkdp 339 k +e+ ++ ta+p+KF +vvea+ +k p lcl|FitnessBrowser__Cola:Echvi_2002 362 KAYMEEHpgyTGvflETAHPGKFGDVVEAVHQEKVTLP 399 *****99865337899*************998887666 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (430 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 14.44 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory