Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate Echvi_2510 Echvi_2510 tryptophan synthase, beta subunit
Query= uniprot:P50383 (425 letters) >FitnessBrowser__Cola:Echvi_2510 Length = 392 Score = 141 bits (356), Expect = 3e-38 Identities = 120/377 (31%), Positives = 178/377 (47%), Gaps = 43/377 (11%) Query: 58 YIKIPE--EVRDRYLS-----IGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKIN 110 Y KI E E +D + + +GRPTPL+ AKRL + + A+IY K E TG+HK+N Sbjct: 33 YEKITESDEFKDEFHALLKDYVGRPTPLYYAKRLSQ--EYGAKIYLKREDLCHTGAHKVN 90 Query: 111 TAIPQAYFAKEEGIEHVVTETGAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIM 170 I Q AK+ G + ++ ETGAGQ G A A ++ M T++M + E++ M Sbjct: 91 NTIGQIILAKKLGKKRIIAETGAGQHGVATATVCALMGMDCTVYMGAIDMERQKPNVERM 150 Query: 171 QLYGANVYASPTNLTEYGRKILETNPQHPGSLGIAMSEAIEYALKN--EFRYLVGSVL-- 226 ++ GA V + + G + L+ A +EA+ + N + Y++GSV+ Sbjct: 151 RILGAKVVPATS-----GSQTLKD----------ATNEALRQWINNPVDTHYIIGSVVGP 195 Query: 227 ----DVVLLHQSVIGQETITQLDLL--GEDADILIGCVGGGSNFGGFTYPFIGNKKGKRY 280 ++V QSVI +E QL ED D++I CVGGGSN G Y + N R Sbjct: 196 HPYPEMVARFQSVISEEIKYQLKEKEGKEDPDMVIACVGGGSNAAGAFYHYY-NTPSVRL 254 Query: 281 IAVSSAEIPKFSKGEYKYDFPDSAGLL---PLVKMITLGKDYVPPPIYAGGLRYHGVAPT 337 +AV +A + S + G+L + M T V P + GL Y G+ P Sbjct: 255 VAVEAAGLGVASGKSAATTALGTPGVLHGSKTLLMQTEDGQVVEPHSISAGLDYPGIGPV 314 Query: 338 LSLLTKEGIVEWREYNEREIFEAAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERK 397 + L E+ + + +A +GI+PA ESAHA+ ++ K Sbjct: 315 HAHLFDSKRGEFYAVEDEDAMKAGVELSRLEGIIPAIESAHAL-----SVLKQLKFKPSD 369 Query: 398 VIVFNLSGHGLLDLSNY 414 VIV NLSG G DL Y Sbjct: 370 VIVINLSGRGDKDLDTY 386 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 392 Length adjustment: 31 Effective length of query: 394 Effective length of database: 361 Effective search space: 142234 Effective search space used: 142234 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate Echvi_2510 Echvi_2510 (tryptophan synthase, beta subunit)
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00263.hmm # target sequence database: /tmp/gapView.30169.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00263 [M=385] Accession: TIGR00263 Description: trpB: tryptophan synthase, beta subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-182 590.8 0.1 7.5e-182 590.5 0.1 1.0 1 lcl|FitnessBrowser__Cola:Echvi_2510 Echvi_2510 tryptophan synthase, Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_2510 Echvi_2510 tryptophan synthase, beta subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 590.5 0.1 7.5e-182 7.5e-182 1 382 [. 8 387 .. 8 389 .. 0.98 Alignments for each domain: == domain 1 score: 590.5 bits; conditional E-value: 7.5e-182 TIGR00263 1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskklggakiylkred 74 g++g+fGG+y+pe+l +++eel+++yek+++ +efk+e++ llk+y+grptpl++ak+ls+++g akiylkred lcl|FitnessBrowser__Cola:Echvi_2510 8 GFYGKFGGAYIPEMLYPNVEELRTNYEKITESDEFKDEFHALLKDYVGRPTPLYYAKRLSQEYG-AKIYLKRED 80 68*************************************************************8.********* PP TIGR00263 75 llhtGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymGaedverqklnvfrmellg 148 l htGahk+nn++gq++lak+lGkkriiaetGaGqhGvatat++al+g++c+vymGa d+erqk+nv rm++lg lcl|FitnessBrowser__Cola:Echvi_2510 81 LCHTGAHKVNNTIGQIILAKKLGKKRIIAETGAGQHGVATATVCALMGMDCTVYMGAIDMERQKPNVERMRILG 154 ************************************************************************** PP TIGR00263 149 akvvpvtsGsktlkdavnealrdWvtsvedthyvlGsavGphPfPeivrefqsvigeevkeqileke.grlPda 221 akvvp tsGs+tlkda+nealr+W+ + dthy++Gs+vGphP+Pe+v +fqsvi+ee+k q++eke ++ Pd+ lcl|FitnessBrowser__Cola:Echvi_2510 155 AKVVPATSGSQTLKDATNEALRQWINNPVDTHYIIGSVVGPHPYPEMVARFQSVISEEIKYQLKEKEgKEDPDM 228 *******************************************************************7789*** PP TIGR00263 222 viacvGGGsnaiGifaafiedeeveligveagGkGidtekhaatlskGkeGvlhGaktkllqdedGqieeahsv 295 viacvGGGsna G+f+++ ++++v+l++vea+G+G+++ k aat + G++GvlhG+kt l+q+edGq+ e hs+ lcl|FitnessBrowser__Cola:Echvi_2510 229 VIACVGGGSNAAGAFYHYYNTPSVRLVAVEAAGLGVASGKSAATTALGTPGVLHGSKTLLMQTEDGQVVEPHSI 302 ************************************************************************** PP TIGR00263 296 saGldypgvgPehaalaetgraeyeaitdeealealkllskeeGiipalesshalaaleklapklkkdeivvvn 369 saGldypg+gP ha+l +++r e+ a++de+a++a ls+ eGiipa+es+hal++l++l+ k +++v+n lcl|FitnessBrowser__Cola:Echvi_2510 303 SAGLDYPGIGPVHAHLFDSKRGEFYAVEDEDAMKAGVELSRLEGIIPAIESAHALSVLKQLKF--KPSDVIVIN 374 ***********************************************************9987..6789***** PP TIGR00263 370 lsGrGdkdletva 382 lsGrGdkdl+t + lcl|FitnessBrowser__Cola:Echvi_2510 375 LSGRGDKDLDTYI 387 *********9866 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (392 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.66 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory