Align prephenate dehydrogenase (EC 1.3.1.12) (characterized)
to candidate Echvi_0125 Echvi_0125 Prephenate dehydrogenase
Query= BRENDA::O67636 (311 letters) >FitnessBrowser__Cola:Echvi_0125 Length = 282 Score = 148 bits (373), Expect = 2e-40 Identities = 86/273 (31%), Positives = 143/273 (52%), Gaps = 5/273 (1%) Query: 30 MQNVLIVGVGFMGGSFAKSLRRSGFKGKIYGYDINPESISKAVDLGIIDEGTTSIAKVED 89 M+ + I+G+G +GGSF+ L+++ + G+D+N + +A+ LGIID +++ Sbjct: 1 MKQIHIIGLGLLGGSFSLGLKKALTGLSVSGFDLNKGHLQEALSLGIIDR----VSETVP 56 Query: 90 FSPDFVMLSSPVRTFREIAKKLSYILSEDATVTDQGSVKGKLVYDLENILGKR-FVGGHP 148 D V++++PV T I +L + + V D GS K + + ++ F+ HP Sbjct: 57 ADTDLVIVATPVDTISGIVSRLLDHIPPETLVVDFGSTKEHICSSVSGHAHRQNFLAAHP 116 Query: 149 IAGTEKSGVEYSLDNLYEGKKVILTPTKKTDKKRLKLVKRVWEDVGGVVEYMSPELHDYV 208 IAGTE +G + +L +GK +IL T KT K R +E + + M P HD Sbjct: 117 IAGTEYAGPSAAFPDLLKGKIMILCETDKTGPDLCKKAYRAFEALEMQIRIMGPHEHDNQ 176 Query: 209 FGVVSHLPHAVAFALVDTLIHMSTPEVDLFKYPGGGFKDFTRIAKSDPIMWRDIFLENKE 268 VSHL H +F L T++ + + G GF R+AKS P MW I ENKE Sbjct: 177 LAFVSHLSHISSFMLGKTVLDKMEDDKHILNMAGSGFASTVRLAKSSPSMWTPIMKENKE 236 Query: 269 NVMKAIEGFEKSLNHLKELIVREAEEELVEYLK 301 N+++A+ G+ ++L ++ +V + EEL + +K Sbjct: 237 NILEALNGYIENLASFRDHLVNDQYEELSKNMK 269 Lambda K H 0.318 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 311 Length of database: 282 Length adjustment: 26 Effective length of query: 285 Effective length of database: 256 Effective search space: 72960 Effective search space used: 72960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory