Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate 3608998 Dshi_2387 carbamoyl-phosphate synthase, small subunit (RefSeq)
Query= SwissProt::P0A6F1 (382 letters) >FitnessBrowser__Dino:3608998 Length = 389 Score = 377 bits (968), Expect = e-109 Identities = 198/374 (52%), Positives = 253/374 (67%), Gaps = 13/374 (3%) Query: 4 SALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNV 63 +A LVL DGT F+GR GA G+ E+ FNT+MTGYQEI+TDPSY+ Q+VT T+PHIGN Sbjct: 9 TACLVLADGTVFYGRGFGAVGTTSAELCFNTAMTGYQEIMTDPSYAGQVVTFTFPHIGNT 68 Query: 64 GTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLR 123 G D+E++ A G+V++ P SN+R L+ +L R + I +DTR+LTR +R Sbjct: 69 GVTAEDDEAADPVAAGMVVKWDPSEPSNWRAQGKLTEWLTRTGRIGIGGVDTRRLTRQIR 128 Query: 124 EKGAQNGCIIAGDNPDAALALE----KARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTG 179 ++GA + + +P+ LE +ARAF GL G+DLA+EVT A++Y W + W Sbjct: 129 QQGAPH--VALAHDPEGNFDLEALVAQARAFAGLEGVDLAREVTCAQSYRWDEQRWAW-- 184 Query: 180 GLPEAKKEDELPFH-VVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFL 238 PE P H VVA D+GAKRNILR L GC +T++PA ++AEDVL NPDG+FL Sbjct: 185 --PEGYTRRTTPGHKVVALDYGAKRNILRCLASAGCDVTVMPATSTAEDVLAQNPDGVFL 242 Query: 239 SNGPGDPAPCD-YAITAIQKFLE-TDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHP 296 SNGPGDPA YA+ I+ LE +D+PVFGICLGHQ+LALA GA+TVKM GHHG NHP Sbjct: 243 SNGPGDPAATGKYAVPMIKGVLEASDVPVFGICLGHQMLALALGAQTVKMNHGHHGANHP 302 Query: 297 VKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEA 356 VKD+E V IT+ NHGF VD TLP + TH+SLFDG+ GI TD+P FS Q HPEA Sbjct: 303 VKDLETGKVEITSMNHGFTVDSQTLPHGVVETHRSLFDGSNCGIRMTDRPVFSVQYHPEA 362 Query: 357 SPGPHDAAPLFDHF 370 SPGP D+ LF+ F Sbjct: 363 SPGPQDSYYLFERF 376 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 493 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 389 Length adjustment: 30 Effective length of query: 352 Effective length of database: 359 Effective search space: 126368 Effective search space used: 126368 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 3608998 Dshi_2387 (carbamoyl-phosphate synthase, small subunit (RefSeq))
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.11725.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-137 443.7 0.0 2.6e-137 443.5 0.0 1.0 1 lcl|FitnessBrowser__Dino:3608998 Dshi_2387 carbamoyl-phosphate sy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3608998 Dshi_2387 carbamoyl-phosphate synthase, small subunit (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 443.5 0.0 2.6e-137 2.6e-137 1 360 [. 10 381 .. 10 382 .. 0.95 Alignments for each domain: == domain 1 score: 443.5 bits; conditional E-value: 2.6e-137 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaeskkikvkglv 77 a lvl+dGtvf g++fga +++ +e++FnT+mtGYqEi+tDpsY+gq+v++t p+ign+gv++ed e+ + ++g+v lcl|FitnessBrowser__Dino:3608998 10 ACLVLADGTVFYGRGFGAVGTTSAELCFNTAMTGYQEIMTDPSYAGQVVTFTFPHIGNTGVTAEDDEAADPVAAGMV 86 579************************************************************************** PP TIGR01368 78 vkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavistekse...keelvekakespkvkev 151 vk +e+sn+ra+ +L+e+l+++g ++i gvDTR l++++R++g+ + +++++ + e lv++a++ + +++v lcl|FitnessBrowser__Dino:3608998 87 VKWDPSEPSNWRAQGKLTEWLTRTGRIGIGGVDTRRLTRQIRQQGAPHVALAHDPEGnfdLEALVAQARAFAGLEGV 163 ***************************************************998865555789999999******** PP TIGR01368 152 nlvkevstkeayeleqk........akkegkklrvvvidlGvKenilreLvkrgvevtvvpadtsaeeikklnpdgi 220 +l++ev++++ y++ ++ +++++ ++vv++d+G K+nilr+L++ g++vtv+pa+++ae++ + npdg+ lcl|FitnessBrowser__Dino:3608998 164 DLAREVTCAQSYRWDEQrwawpegyTRRTTPGHKVVALDYGAKRNILRCLASAGCDVTVMPATSTAEDVLAQNPDGV 240 ***************9556666676666666699******************************************* PP TIGR01368 221 llsnGPGdPaav.eeaietvkkllea.kiPifGIclGhqllalalgaktyklkfGhrGaNhpvkdlktgrveitsqN 295 +lsnGPGdPaa ++a+ ++k +lea ++P+fGIclGhq+lalalga+t+k++ Gh+GaNhpvkdl+tg+veits N lcl|FitnessBrowser__Dino:3608998 241 FLSNGPGDPAATgKYAVPMIKGVLEAsDVPVFGICLGHQMLALALGAQTVKMNHGHHGANHPVKDLETGKVEITSMN 317 *********776377899******9989************************************************* PP TIGR01368 296 HgyavdeeslkeeelevthvnlnDgtveglehkelpvfsvQyHPeaspGphdteylFdefvelik 360 Hg++vd+++l+++ + th++l+Dg++ g+++++ pvfsvQyHPeaspGp+d+ ylF++f +++ lcl|FitnessBrowser__Dino:3608998 318 HGFTVDSQTLPHG-VVETHRSLFDGSNCGIRMTDRPVFSVQYHPEASPGPQDSYYLFERFAAAMA 381 *********9877.889*******************************************99885 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (389 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.22 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory