Align Histidinol dehydrogenase; HDH; EC 1.1.1.23 (uncharacterized)
to candidate 3608641 Dshi_2034 Histidinol dehydrogenase (RefSeq)
Query= curated2:Q5SKC1 (412 letters) >FitnessBrowser__Dino:3608641 Length = 435 Score = 268 bits (685), Expect = 2e-76 Identities = 147/399 (36%), Positives = 235/399 (58%), Gaps = 11/399 (2%) Query: 24 EEIVRGILEAVREEGDEALDRFSRDLDGYPVEEVPKR-AWREAYEDLDEDLRDALETARE 82 ++IVR IL+ + GD+A ++R D Y E + + A A + E L+ ++ A Sbjct: 21 KKIVRAILDEIEAGGDDAALAYARKFDNYEGEILLSQDAIDAAIAQVPEKLKHDIDFAHA 80 Query: 83 RIEAF---YREEARGGFLRAEGGGVLAQLVRPLERVGVYVPGGSAPLLSTLLMTVVPAKV 139 ++ F R+ + G + Q P+ G YVPGG +++ +MTV AKV Sbjct: 81 NVKRFAEAQRDTVANFEIEVVPGLIAGQKAIPVHAAGCYVPGGRYSHIASAIMTVTTAKV 140 Query: 140 AGVREVIVASPPK----VHPGVLAAAWVAGADRLFAMGGAQAIAALAYGTGRVPRVDKIV 195 AG + ++ SPP+ + P ++ AA V GAD++ AMGG Q +AA+ +G +P+ + +V Sbjct: 141 AGCKHIVACSPPRPDVGIAPAIVYAAHVCGADKIMAMGGVQGVAAMTFGLFGLPKANILV 200 Query: 196 GPGNRYVVAAKRLVYGTVGIDGLAGPTETMIIADGSASPRLLAADLLAQAEHGPDSEPWL 255 GPGN++V AKR+++G VGID +AGPT+++I+AD SA P ++A DL+ QAEHG +S WL Sbjct: 201 GPGNQFVAEAKRMLFGRVGIDMIAGPTDSLILADASADPMVVAVDLVGQAEHGYNSPVWL 260 Query: 256 LSPDRALLERVEAELSWQLQDLP---RAEVARQALEKGGLVLTKDLEEAFALANLYAPEH 312 ++ DRAL E+V + + DLP R + +++ D EE A ++ YAPEH Sbjct: 261 VTDDRALAEKVMELVPGLIDDLPDVNRENATAAWRDYAEVIVCADREEMAATSDEYAPEH 320 Query: 313 LSLALSDPLPWLEKVQNAGGVFLGEGSPEALGDYIAGPSHVMPTSGTARFQGGLAVRDFL 372 L++ D WLE++ G +FLGE + A GD +G +HV+PTSG A + GGL+V ++ Sbjct: 321 LTVQAEDLDWWLERLSCYGSLFLGEETTVAFGDKASGTNHVLPTSGAANYTGGLSVHKYM 380 Query: 373 KVIPVVGLSEGAARELAKKGALLARAEGLEGHARSLDLR 411 K++ + ++ +A A ++R EG+EGHAR+ D+R Sbjct: 381 KIVTWQRSTREGSKPVALATARISRLEGMEGHARTADIR 419 Lambda K H 0.318 0.137 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 412 Length of database: 435 Length adjustment: 32 Effective length of query: 380 Effective length of database: 403 Effective search space: 153140 Effective search space used: 153140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate 3608641 Dshi_2034 (Histidinol dehydrogenase (RefSeq))
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00069.hmm # target sequence database: /tmp/gapView.8897.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00069 [M=393] Accession: TIGR00069 Description: hisD: histidinol dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-138 445.9 0.3 9.2e-138 445.6 0.3 1.0 1 lcl|FitnessBrowser__Dino:3608641 Dshi_2034 Histidinol dehydrogena Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3608641 Dshi_2034 Histidinol dehydrogenase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 445.6 0.3 9.2e-138 9.2e-138 1 393 [] 24 419 .. 24 419 .. 0.98 Alignments for each domain: == domain 1 score: 445.6 bits; conditional E-value: 9.2e-138 TIGR00069 1 vkeiiedvrkeGdeAlleytekfdkvkleslrvseeeleealeavdeelkealelaaeniekfhekqlpes..veve 75 v++i++++++ Gd+A l+y++kfd+++ ++ +s++ +++a ++v+e+lk++++ a++n+++f+e+q+++ +e+e lcl|FitnessBrowser__Dino:3608641 24 VRAILDEIEAGGDDAALAYARKFDNYE-GEILLSQDAIDAAIAQVPEKLKHDIDFAHANVKRFAEAQRDTVanFEIE 99 789***********************6.889************************************9775459999 PP TIGR00069 76 teegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAgvkeivvvtPpkkdgkvnpavlaaakllgvdevyk 152 +g ++gqk+ p++++g+YvPgG+++++++++mt+ +AkvAg+k+iv+++Pp+ d ++pa+++aa+++g+d++++ lcl|FitnessBrowser__Dino:3608641 100 VVPGLIAGQKAIPVHAAGCYVPGGRYSHIASAIMTVTTAKVAGCKHIVACSPPRPDVGIAPAIVYAAHVCGADKIMA 176 ******************************************************9********************** PP TIGR00069 153 vGGaqaiaalayGtetvpkvdkivGPGniyVtaAKklvfgevgidmiaGPsEvlviadesanpelvaaDllsqaEHd 229 +GG+q++aa+++G+ +pk++++vGPGn++V++AK+++fg+vgidmiaGP++ l++ad+sa+p +va+Dl+ qaEH+ lcl|FitnessBrowser__Dino:3608641 177 MGGVQGVAAMTFGLFGLPKANILVGPGNQFVAEAKRMLFGRVGIDMIAGPTDSLILADASADPMVVAVDLVGQAEHG 253 ***************************************************************************** PP TIGR00069 230 edaqailvttseelaekveeeveeqleele..rkeiaekslekngaiilvddleealelsneyApEHLelqtkdpee 304 ++ ++lvt++++laekv e v +++l+ ++e a++++++++++i+++d ee++++s+eyApEHL++q++d lcl|FitnessBrowser__Dino:3608641 254 YNSPVWLVTDDRALAEKVMELVPGLIDDLPdvNRENATAAWRDYAEVIVCADREEMAATSDEYAPEHLTVQAEDLDW 330 *****************************977799****************************************** PP TIGR00069 305 llkkiknaGsvflGeytpealgdyvaGpnhvLPTsgtArfasglsvedFlkrisvqelskealeelaeaveklaeaE 381 +l++++ +Gs+flGe t++a+gd+++G+nhvLPTsg+A++++glsv++++k +++q+ ++e+ + +a a+++++++E lcl|FitnessBrowser__Dino:3608641 331 WLERLSCYGSLFLGEETTVAFGDKASGTNHVLPTSGAANYTGGLSVHKYMKIVTWQRSTREGSKPVALATARISRLE 407 ***************************************************************************** PP TIGR00069 382 gLeaHaeavevR 393 g+e Ha+++++R lcl|FitnessBrowser__Dino:3608641 408 GMEGHARTADIR 419 *******99998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (435 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 8.97 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory