Align Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 (characterized)
to candidate 3609547 Dshi_2931 ribose-phosphate pyrophosphokinase (RefSeq)
Query= SwissProt::P0A1V6 (315 letters) >FitnessBrowser__Dino:3609547 Length = 340 Score = 314 bits (804), Expect = 2e-90 Identities = 164/319 (51%), Positives = 222/319 (69%), Gaps = 11/319 (3%) Query: 5 KLFAGNATPELAQRIANRLYTSLG------DAAVGRFSDGEVSVQINENVRGGDIFIIQS 58 K+ +GNA ELA I+ R+ G DA V RF+DGE+ V++ ENVRG D+FIIQS Sbjct: 8 KIISGNANQELAHAISRRMSAYRGMTVGLVDARVERFNDGEIFVEVFENVRGEDMFIIQS 67 Query: 59 TCAPTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLS 118 T P NDNLMEL++M DALRR+SA RITA+IPYFGYARQDRR + AR PITAK+VA+ + Sbjct: 68 TSNPANDNLMELLIMCDALRRSSAARITAIIPYFGYARQDRRTK-ARTPITAKLVANMMV 126 Query: 119 SVGVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQL---NLDNPIVVSPDIGGVV 175 G++RVLT+DLHA QIQGFFD+PVDN++ +PI D++ LDN VVSPD+GGV Sbjct: 127 EAGIERVLTMDLHAAQIQGFFDIPVDNLYAAPIFALDVMHNFAGRLDNVTVVSPDVGGVA 186 Query: 176 RARAIAKLLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEA 235 RAR +A+ + +AI+DKRR + V + M +IG+V G+ C++VDD+ DT GTLCKAA+ Sbjct: 187 RARELAQRIG-CGLAIVDKRRSQPGVVEEMTVIGEVEGQTCIIVDDICDTAGTLCKAADL 245 Query: 236 LKERGAKRVFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLTDEIKALPNVRTLTLSGM 295 L GA V +Y TH + SG A + S + +V+ D+I TD +KA PN+R + + + Sbjct: 246 LISEGASEVHSYITHGVLSGPAVERITKSNMKSLVITDSIGATDAVKAAPNIRIVPTAPV 305 Query: 296 LAEAIRRISNEESISAMFE 314 A+AI I N S+S++F+ Sbjct: 306 FAQAILNIWNGTSVSSLFD 324 Lambda K H 0.322 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 340 Length adjustment: 28 Effective length of query: 287 Effective length of database: 312 Effective search space: 89544 Effective search space used: 89544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate 3609547 Dshi_2931 (ribose-phosphate pyrophosphokinase (RefSeq))
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.22384.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-114 365.9 0.4 7.9e-114 365.7 0.4 1.0 1 lcl|FitnessBrowser__Dino:3609547 Dshi_2931 ribose-phosphate pyrop Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3609547 Dshi_2931 ribose-phosphate pyrophosphokinase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 365.7 0.4 7.9e-114 7.9e-114 2 309 .] 8 324 .. 7 324 .. 0.96 Alignments for each domain: == domain 1 score: 365.7 bits; conditional E-value: 7.9e-114 TIGR01251 2 kilsgssskelaekvaknlg......lelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmelllli 72 ki+sg++++ela++++++++ + l+d++v++F dgE+ v++ e+vrg+d+fii qsts+p nd+lmell+++ lcl|FitnessBrowser__Dino:3609547 8 KIISGNANQELAHAISRRMSayrgmtVGLVDARVERFNDGEIFVEVFENVRGEDMFII-QSTSNPANDNLMELLIMC 83 799*********9998875422222257899***************************.****************** PP TIGR01251 73 dalkrasaksvtaviPyygYaRqdkkaksrepisaklvaklleeaGadrvltvdlHseqiqgfFdvpvenlsaspkl 149 dal+r+sa ++ta+iPy+gYaRqd+++k r+pi+aklva+++ eaG++rvlt+dlH+ qiqgfFd+pv+nl+a+p + lcl|FitnessBrowser__Dino:3609547 84 DALRRSSAARITAIIPYFGYARQDRRTKARTPITAKLVANMMVEAGIERVLTMDLHAAQIQGFFDIPVDNLYAAPIF 160 ***************************************************************************** PP TIGR01251 150 ieelkkke...lknlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnllgdvegkdvvivDDiisTg 223 + ++ ++ l+n++vvsPD G+v+ra+++a+++g+ lai++K+R + +ve + ++g+veg++++ivDDi +T+ lcl|FitnessBrowser__Dino:3609547 161 ALDVMHNFagrLDNVTVVSPDVGGVARARELAQRIGCGLAIVDKRRS-QPGVVEEMTVIGEVEGQTCIIVDDICDTA 236 *****999999************************************.666************************** PP TIGR01251 224 gTlvkaaelLkekGAkkvivaathgvfsgdAlerlaeagveevivtntilv.ee.kklpkvseisvapliaeaiari 298 gTl+kaa+lL ++GA++v ++thgv+sg+A+er++++ ++ +++t++i + k+ p+++ + ap++a+ai++i lcl|FitnessBrowser__Dino:3609547 237 GTLCKAADLLISEGASEVHSYITHGVLSGPAVERITKSNMKSLVITDSIGAtDAvKAAPNIRIVPTAPVFAQAILNI 313 ***************************************************5559********************** PP TIGR01251 299 henesvsslfd 309 +++svsslfd lcl|FitnessBrowser__Dino:3609547 314 WNGTSVSSLFD 324 *********96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (340 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 12.12 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory