Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate 3606718 Dshi_0149 dihydrodipicolinate synthase (RefSeq)
Query= BRENDA::Q8UGL3 (294 letters) >FitnessBrowser__Dino:3606718 Length = 291 Score = 374 bits (960), Expect = e-108 Identities = 195/293 (66%), Positives = 228/293 (77%), Gaps = 3/293 (1%) Query: 1 MFKGSIPALITPFTDNGSVDEKAFAAHVEWQIAEGSNGLVPVGTTGESPTLSHDEHKRVV 60 MFKGS+PAL+TP D G+VD A VEWQIAEGS+GLVPVGTTGESPTLSH+EH+ VV Sbjct: 1 MFKGSMPALVTPMKD-GAVDFATLEALVEWQIAEGSHGLVPVGTTGESPTLSHEEHEAVV 59 Query: 61 ELCIEVAAKRVPVIAGAGSNNTDEAIELALHAQEAGADALLVVTPYYNKPTQKGLFAHFS 120 IEVAA RVPVIAGAGSNNT EA+ HA++AGAD LVVTPYYNKPTQ G+ AH++ Sbjct: 60 AKVIEVAAGRVPVIAGAGSNNTVEAVRFVRHAKDAGADGALVVTPYYNKPTQGGMIAHYT 119 Query: 121 AVAEAVKLPIVIYNIPPRSVVDMSPETMGALVKAHKNIIGVKDATGKLDRVSEQRISCGK 180 A+AEA +PIVIYNIP RSVVDM+P TM AL A I+GVKDATG L RVS+ R++CG Sbjct: 120 ALAEAADIPIVIYNIPGRSVVDMTPATMAALA-ALPTIVGVKDATGDLARVSQTRMACGP 178 Query: 181 DFVQLSGEDGTALGFNAHGGVGCISVTANVAPRLCSEFQAAMLAGDYAKALEYQDRLMPL 240 +F+QLSGED TALGFNAHGGVGCISVTANVAP LC++FQ A LAGD+A AL QD+LMPL Sbjct: 179 EFIQLSGEDATALGFNAHGGVGCISVTANVAPALCAQFQEATLAGDFATALALQDKLMPL 238 Query: 241 HRAIFMEPGVCGTKYALSKTRGGNRRVRSPLMSTLEPATEAAIDAALKHAGLM 293 H AIF+EPG+ G KYALS + VR PL+ L T+ I A+ HAG++ Sbjct: 239 HEAIFVEPGLVGAKYALSLLGKCSEDVRLPLLG-LSDGTKVLIKDAMIHAGIL 290 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 291 Length adjustment: 26 Effective length of query: 268 Effective length of database: 265 Effective search space: 71020 Effective search space used: 71020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate 3606718 Dshi_0149 (dihydrodipicolinate synthase (RefSeq))
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.27375.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-100 319.5 0.0 8e-100 319.3 0.0 1.0 1 lcl|FitnessBrowser__Dino:3606718 Dshi_0149 dihydrodipicolinate sy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3606718 Dshi_0149 dihydrodipicolinate synthase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 319.3 0.0 8e-100 8e-100 2 283 .. 5 284 .. 4 287 .. 0.98 Alignments for each domain: == domain 1 score: 319.3 bits; conditional E-value: 8e-100 TIGR00674 2 vltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvpviaGtgsna 78 +++Al+TP+k+ vdfa+le l+e qi++g+ ++v+vGtTGEs+tLs+eE+++v+ +++e++++rvpviaG+gsn+ lcl|FitnessBrowser__Dino:3606718 5 SMPALVTPMKDGA-VDFATLEALVEWQIAEGSHGLVPVGTTGESPTLSHEEHEAVVAKVIEVAAGRVPVIAGAGSNN 80 789******9887.*************************************************************** PP TIGR00674 79 teeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgvslepetvkrLaeeveiv 155 t ea++++++a+++g+dg+lvvtPyYnkPtq G+++h+ a+ae++++Pi++Yn+P+R++v+++p t+++La+ ++iv lcl|FitnessBrowser__Dino:3606718 81 TVEAVRFVRHAKDAGADGALVVTPYYNKPTQGGMIAHYTALAEAADIPIVIYNIPGRSVVDMTPATMAALAALPTIV 157 ***************************************************************************** PP TIGR00674 156 aiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasnvapkelkemvkaalegdteeareihqk 232 ++K+a+gdl+rvs+ + + +f lsG+Da++l + a G+ G iSV++nvap +++++ +a+l+gd++ a+ ++ k lcl|FitnessBrowser__Dino:3606718 158 GVKDATGDLARVSQTRMACGPEFIQLSGEDATALGFNAHGGVGCISVTANVAPALCAQFQEATLAGDFATALALQDK 234 ***************************************************************************** PP TIGR00674 233 llklfkalfietNPipvKtalallgliekdelRlPLtelseekkeklkevl 283 l++l++a+f+e+ ++ K+al llg + + ++RlPL ls+ +k +k+++ lcl|FitnessBrowser__Dino:3606718 235 LMPLHEAIFVEPGLVGAKYALSLLGKCSE-DVRLPLLGLSDGTKVLIKDAM 284 ****************************9.9**********9999988875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (291 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.19 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory