Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate 3608188 Dshi_1593 Homoserine O-succinyltransferase (RefSeq)
Query= SwissProt::Q5LSN6 (312 letters) >FitnessBrowser__Dino:3608188 Length = 305 Score = 536 bits (1382), Expect = e-157 Identities = 248/304 (81%), Positives = 277/304 (91%) Query: 1 MPIKIPAHLPAYDILTREGVMVMSEDQAARQDIRPLRIGLLNLMPKKIQTETQFARLIGA 60 MPIKIP LPA+D+L+ EGVMVM + +A RQDIRPL+IGLLNLMPKKIQTETQFARLIGA Sbjct: 1 MPIKIPETLPAFDVLSSEGVMVMGQGRADRQDIRPLQIGLLNLMPKKIQTETQFARLIGA 60 Query: 61 TPLQIELSLIRMTEHQTKTTASEHMEEFYRPFQEVRDEKFDGLIITGAPIEHLEFSDVTY 120 TPLQI+L+LIRMTEHQ+K T++ HME FYRPF EVRD KFDGLIITGAPIEHLEF+DVTY Sbjct: 61 TPLQIDLTLIRMTEHQSKHTSAAHMEAFYRPFAEVRDRKFDGLIITGAPIEHLEFADVTY 120 Query: 121 WDELGEVFAWTQSNVHSTFGVCWGGMAMINHFHGIRKHMLDHKAFGCFRHRNLDPASPYL 180 WDEL EVFAWTQ+NVH+TFGVCWGGMAMINHFHG++KH+L KAFGCFRHRNL PASPYL Sbjct: 121 WDELREVFAWTQTNVHATFGVCWGGMAMINHFHGVQKHILPAKAFGCFRHRNLAPASPYL 180 Query: 181 RGFSDDFVIPVSRWTEVKQAEVDAVPELVTLLGSDEVGPCLISDPGHRALYIFNHFEYDS 240 RGFSDD VIPVSRWTE+KQ+E+DAVP L TLLGS EVGPCL+ DPGHRALYIFNHFEYD+ Sbjct: 181 RGFSDDCVIPVSRWTEMKQSEIDAVPGLTTLLGSPEVGPCLVEDPGHRALYIFNHFEYDT 240 Query: 241 DTLKQEYDRDVEGGTAINVPINYYPDDDPSRKPLNRWRSHAHLLYGNWISEIYETTPYDM 300 TLK+EYDRDVE GT INVP NYYPDDDP+R PLNRWRSHAHLLYGNW++EIY+TT YD+ Sbjct: 241 GTLKEEYDRDVENGTPINVPTNYYPDDDPARAPLNRWRSHAHLLYGNWLNEIYQTTEYDL 300 Query: 301 ARIG 304 +IG Sbjct: 301 EKIG 304 Lambda K H 0.321 0.139 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 473 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 312 Length of database: 305 Length adjustment: 27 Effective length of query: 285 Effective length of database: 278 Effective search space: 79230 Effective search space used: 79230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory