GapMind for Amino acid biosynthesis

 

Alignments for a candidate for cmutase in Dinoroseobacter shibae DFL-12

Align candidate 3606921 Dshi_0349 (chorismate mutase (RefSeq))
to HMM TIGR01795 (chorismate mutase (EC 5.4.99.5))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01795.hmm
# target sequence database:        /tmp/gapView.10028.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01795  [M=94]
Accession:   TIGR01795
Description: CM_mono_cladeE: chorismate mutase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
    3.2e-38  116.5   1.0    3.6e-38  116.3   1.0    1.0  1  lcl|FitnessBrowser__Dino:3606921  Dshi_0349 chorismate mutase (Ref


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Dino:3606921  Dshi_0349 chorismate mutase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  116.3   1.0   3.6e-38   3.6e-38       5      88 ..      12      95 ..       8      98 .] 0.96

  Alignments for each domain:
  == domain 1  score: 116.3 bits;  conditional E-value: 3.6e-38
                         TIGR01795  5 lkalrdsidnidaaviallaerfkatkqvGvlkaeaglaPadparedrqiarlralaadakldPefaekflnfivkevi 83
                                      l+  rdsid +da ++  laerfk t++vG lkae+ l+P dp+re+ qi+rl  la+ a+ldP+fa+kflnfi++evi
  lcl|FitnessBrowser__Dino:3606921 12 LAEHRDSIDRLDAILVFTLAERFKHTQAVGRLKAEHALPPSDPTREESQIKRLSELAEMADLDPDFAKKFLNFIIQEVI 90
                                      7788*************************************************************************** PP

                         TIGR01795 84 krher 88
                                      ++h++
  lcl|FitnessBrowser__Dino:3606921 91 QHHKQ 95
                                      ***86 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (94 nodes)
Target sequences:                          1  (98 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 2.92
//
[ok]

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory