Align Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic; AGPR; N-acetyl-glutamate semialdehyde dehydrogenase; NAGSA dehydrogenase; EC 1.2.1.38 (characterized)
to candidate 3608357 Dshi_1759 N-acetyl-gamma-glutamyl-phosphate reductase (RefSeq)
Query= SwissProt::Q93Z70 (401 letters) >FitnessBrowser__Dino:3608357 Length = 341 Score = 367 bits (943), Expect = e-106 Identities = 189/342 (55%), Positives = 242/342 (70%), Gaps = 5/342 (1%) Query: 61 IGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKDA 120 I +LGASGYTGAE+VRL+A HP ++T ++ADRKAGQ+M +VFPHLR LP LV + D Sbjct: 4 IAILGASGYTGAELVRLIATHPRMRITALSADRKAGQTMGAVFPHLRHLDLPALVKIDDI 63 Query: 121 DFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQK 180 DF VD VFC LPH T+Q +I LP ++KIVDLSADFRLR+ Y +WYG PH A++LQ Sbjct: 64 DFGGVDLVFCALPHATSQSVIAALPKSVKIVDLSADFRLRDPEAYAKWYGGPHAALDLQA 123 Query: 181 EVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGAG 240 E VYGLTE RE I+ ARLVA GC T Q L PL+ A +I + IIID K+GVSGAG Sbjct: 124 EAVYGLTEFYREQIRDARLVAGTGCNAATGQYALRPLIAAGVIDLDEIIIDLKTGVSGAG 183 Query: 241 RGAKEANLYSEIAEGISSYGV-TRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQS 299 R KE L++E++EG +Y V HRH+ E +Q S +A ++ V FTPHL+P RG+ + Sbjct: 184 RSLKENLLHAELSEGAHAYAVGGMHRHLGEFDQEFSALAGREIKVQFTPHLLPANRGILA 243 Query: 300 TIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIPG 359 T+YV+ G TE ++ L +YEDE FV +L EG P T +VRGSN+ H+ V DRIPG Sbjct: 244 TVYVK---GEATE-IYDALADAYEDEPFVVMLPEGEHPSTRHVRGSNFVHIGVVRDRIPG 299 Query: 360 RAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 401 RA++I+ +DNL KG+SGQALQN N+ML ETTGL+ P+FP Sbjct: 300 RAVVIAALDNLTKGSSGQALQNANLMLDIEETTGLMMTPVFP 341 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 341 Length adjustment: 30 Effective length of query: 371 Effective length of database: 311 Effective search space: 115381 Effective search space used: 115381 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate 3608357 Dshi_1759 (N-acetyl-gamma-glutamyl-phosphate reductase (RefSeq))
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.9941.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-118 379.4 0.0 1e-117 379.2 0.0 1.0 1 lcl|FitnessBrowser__Dino:3608357 Dshi_1759 N-acetyl-gamma-glutamy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3608357 Dshi_1759 N-acetyl-gamma-glutamyl-phosphate reductase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 379.2 0.0 1e-117 1e-117 2 345 .] 3 341 .] 2 341 .] 0.97 Alignments for each domain: == domain 1 score: 379.2 bits; conditional E-value: 1e-117 TIGR01850 2 kvaivGasGYtGaeLlrllakHpevevtklvssreagkklsevhphlkglvdlkleeleeeeileeadvvflAlphg 78 ++ai+GasGYtGaeL+rl+a+Hp++++t+l ++r+ag+++ +v+phl++l l ++++ + +d+vf+Alph lcl|FitnessBrowser__Dino:3608357 3 NIAILGASGYTGAELVRLIATHPRMRITALSADRKAGQTMGAVFPHLRHLDLPALVKIDDID-FGGVDLVFCALPHA 78 79***********************************************9987777777754.569*********** PP TIGR01850 79 vsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelleeavYGlpElnreeikkaklianPGCyaTaal 155 +s++++ ++l k+vk++dlSadfRl+d+e+Y+kwYg +h++ +l++eavYGl+E++re+i++a+l+a GC+a + + lcl|FitnessBrowser__Dino:3608357 79 TSQSVI-AALPKSVKIVDLSADFRLRDPEAYAKWYGGPHAALDLQAEAVYGLTEFYREQIRDARLVAGTGCNAATGQ 154 ******.567888**************************************************************** PP TIGR01850 156 LalaPllkekliepksiivdaksGvSgAGrkasekslfaevnenlkpYkvt.kHrHtpEieqelsklaekkvkvsft 231 al Pl+++++i+ ++ii+d k+GvSgAGr+ +e+ l+ae++e ++Y+v HrH E qe s+la++++kv+ft lcl|FitnessBrowser__Dino:3608357 155 YALRPLIAAGVIDLDEIIIDLKTGVSGAGRSLKENLLHAELSEGAHAYAVGgMHRHLGEFDQEFSALAGREIKVQFT 231 **************************************************989************************ PP TIGR01850 232 phlvpmtrGilatiyaklkkelteeelrklyeevYedepfvrvlkegelPstkavlgsnfvdigvavdeetkrvvvv 308 phl+p rGilat+y+k ++ +e++++++++Yedepfv +l+ege Pst++v+gsnfv+igv d+ +r+vv+ lcl|FitnessBrowser__Dino:3608357 232 PHLLPANRGILATVYVKGEA----TEIYDALADAYEDEPFVVMLPEGEHPSTRHVRGSNFVHIGVVRDRIPGRAVVI 304 *****************998....89*************************************************** PP TIGR01850 309 saiDNLvKGaagqAvqnlNlmlgfdetegLeklpllp 345 +a+DNL+KG +gqA+qn Nlml+ +et+gL ++p++p lcl|FitnessBrowser__Dino:3608357 305 AALDNLTKGSSGQALQNANLMLDIEETTGLMMTPVFP 341 **********************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (341 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.11 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory