Align Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate 3609934 Dshi_3316 phosphoserine phosphatase SerB (RefSeq)
Query= SwissProt::Q12A06 (236 letters) >FitnessBrowser__Dino:3609934 Length = 292 Score = 165 bits (417), Expect = 1e-45 Identities = 99/209 (47%), Positives = 123/209 (58%), Gaps = 5/209 (2%) Query: 26 LIAFDMDSTLINIECVDEIADAAGRKAEVAAITEAAMRGEISDYKESLRQRVALLKGVSV 85 ++ DMDST+I EC+DE+AD AG VA IT AM GE+ D++ +LR+RV LL G+ Sbjct: 78 MLLADMDSTMIRQECIDELADEAGVGPRVAEITARAMNGEL-DFEGALRERVGLLAGLDA 136 Query: 86 ASMDEVYRTRLRLNPGAARLVQACKDAGLKVLLVSGGFTFFTDRIRDELGIDYTRSNVLE 145 A +D V TR+ L PG LV K G LVSGGFT FT R+ LG D R+N LE Sbjct: 137 AVIDRVLETRIDLMPGGRALVATMKRDGAYAALVSGGFTAFTARVAALLGFDENRANTLE 196 Query: 146 TTDGLLTGRMVDQPWGDICDGEEKRKMLLETCGQLGISPRQAIAMGDGANDLPMMGEAGL 205 DG+LTGR+++ I K L E +LGIS +A+GDGANDL M+G AG Sbjct: 197 IVDGVLTGRVIE----PILGRAAKVAALEEITARLGISEADVMAVGDGANDLGMLGRAGA 252 Query: 206 SVAYHAKPRVREQAMVAINEGGLDRLLEL 234 VA HAKP V + IN G L LL L Sbjct: 253 GVALHAKPVVAAECDRRINFGDLSALLFL 281 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 292 Length adjustment: 25 Effective length of query: 211 Effective length of database: 267 Effective search space: 56337 Effective search space used: 56337 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate 3609934 Dshi_3316 (phosphoserine phosphatase SerB (RefSeq))
to HMM TIGR00338 (serB: phosphoserine phosphatase SerB (EC 3.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00338.hmm # target sequence database: /tmp/gapView.23641.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00338 [M=219] Accession: TIGR00338 Description: serB: phosphoserine phosphatase SerB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-64 203.0 0.2 3e-64 202.6 0.2 1.0 1 lcl|FitnessBrowser__Dino:3609934 Dshi_3316 phosphoserine phosphat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3609934 Dshi_3316 phosphoserine phosphatase SerB (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 202.6 0.2 3e-64 3e-64 12 216 .. 74 279 .. 65 281 .. 0.96 Alignments for each domain: == domain 1 score: 202.6 bits; conditional E-value: 3e-64 TIGR00338 12 kkkklvvfDlDstlieeEvIdeiaklaGveeeVseiTerAmrgeldFkeslreRvkllkglpvellkkv.eeklelt 87 + k +++ D+Dst+i++E+Ide+a +aGv+ V+eiT rAm+geldF+ +lreRv ll gl++ ++++v e +++l+ lcl|FitnessBrowser__Dino:3609934 74 RRKAMLLADMDSTMIRQECIDELADEAGVGPRVAEITARAMNGELDFEGALRERVGLLAGLDAAVIDRVlETRIDLM 150 56778999********************************************************999983558**** PP TIGR00338 88 eGveelvkkLkekgykvaviSGgFdlvaeklkekLgldavfaNrLevedgkltGkvegeivdesakaktllklleke 164 +G + lv ++k+ g a++SGgF+ ++ ++++ Lg d aN+Le+ dg ltG+v +i+ ak l++++ + lcl|FitnessBrowser__Dino:3609934 151 PGGRALVATMKRDGAYAALVSGGFTAFTARVAALLGFDENRANTLEIVDGVLTGRVIEPILGRAAKVAALEEITARL 227 ***************************************************************************** PP TIGR00338 165 gislektvavGDGanDlsmikaAglgiafnakpvlkekadiviekkdltdil 216 gis ++++avGDGanDl m+ +Ag+g+a +akpv+ + d i+ dl ++l lcl|FitnessBrowser__Dino:3609934 228 GISEADVMAVGDGANDLGMLGRAGAGVALHAKPVVAAECDRRINFGDLSALL 279 ************************************************9887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (219 nodes) Target sequences: 1 (292 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.13 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory