Align Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 (characterized)
to candidate N515DRAFT_3805 N515DRAFT_3805 ribose-phosphate pyrophosphokinase
Query= SwissProt::P0A1V6 (315 letters) >FitnessBrowser__Dyella79:N515DRAFT_3805 Length = 320 Score = 383 bits (983), Expect = e-111 Identities = 192/309 (62%), Positives = 248/309 (80%), Gaps = 1/309 (0%) Query: 6 LFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCAPTND 65 LF GNA LA+ +A RL LG A VGRFSDGE ++I ENVR ++F+IQ T AP+ + Sbjct: 10 LFTGNAHRALAEDVATRLGVPLGKALVGRFSDGETQIEIEENVRRQEVFVIQPTGAPSAE 69 Query: 66 NLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVGVDRV 125 NL EL+ +VDAL+RASA +TAV+PYFGYARQDRR RSARVPITAK+VA + +VGVDRV Sbjct: 70 NLFELLTLVDALKRASAASVTAVMPYFGYARQDRRPRSARVPITAKMVAKMIGTVGVDRV 129 Query: 126 LTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQ-LNLDNPIVVSPDIGGVVRARAIAKLL 184 LTVDLHA+QIQGFFD+PVDNV+ SP+LL D+ + ++DN IVVSPD+GGVVRARA+AK L Sbjct: 130 LTVDLHADQIQGFFDIPVDNVYASPLLLADIWRNHSMDNLIVVSPDVGGVVRARALAKRL 189 Query: 185 NDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRV 244 +D D+AIIDKRRP+ANV+ VM+IIGDV G+ CVLVDD++DT GTLC AA ALKERGA++V Sbjct: 190 DDADLAIIDKRRPKANVATVMNIIGDVDGKTCVLVDDIVDTAGTLCAAAAALKERGARKV 249 Query: 245 FAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLTDEIKALPNVRTLTLSGMLAEAIRRIS 304 AY HP+ SG A +N+ NS +D++VV +T+PL E +A +R L+++ +LAE IRRI+ Sbjct: 250 VAYCVHPVLSGAAISNIENSQLDQLVVTNTLPLRPEAQACAKIRQLSVAELLAETIRRIA 309 Query: 305 NEESISAMF 313 ES+S+++ Sbjct: 310 FGESVSSLY 318 Lambda K H 0.322 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 320 Length adjustment: 27 Effective length of query: 288 Effective length of database: 293 Effective search space: 84384 Effective search space used: 84384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate N515DRAFT_3805 N515DRAFT_3805 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.586.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-119 383.1 0.2 4.5e-119 382.9 0.2 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_3805 N515DRAFT_3805 ribose-phosphate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_3805 N515DRAFT_3805 ribose-phosphate pyrophosphokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 382.9 0.2 4.5e-119 4.5e-119 2 308 .. 9 318 .. 8 319 .. 0.98 Alignments for each domain: == domain 1 score: 382.9 bits; conditional E-value: 4.5e-119 TIGR01251 2 kilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalme 67 +++ g+++++lae va +lg++lg++ v +F+dgE++++iee+vr ++vf+i q t ap ++l+e lcl|FitnessBrowser__Dyella79:N515DRAFT_3805 9 MLFTGNAHRALAEDVATRLGVPLGKALVGRFSDGETQIEIEENVRRQEVFVI-QPTGAPSAENLFE 73 6899************************************************.99999******** PP TIGR01251 68 llllidalkrasaksvtaviPyygYaRqdkkak.srepisaklvaklleeaGadrvltvdlHseqi 132 ll+l+dalkrasa svtav+Py+gYaRqd++ + r pi+ak+vak++ ++G+drvltvdlH++qi lcl|FitnessBrowser__Dyella79:N515DRAFT_3805 74 LLTLVDALKRASAASVTAVMPYFGYARQDRRPRsARVPITAKMVAKMIGTVGVDRVLTVDLHADQI 139 ******************************97758******************************* PP TIGR01251 133 qgfFdvpvenlsaspklieelkkke.lknlvvvsPDkGaverakkvakklg.lelaiieKeRdske 196 qgfFd+pv+n++asp l++++ +++ ++nl+vvsPD G+v ra+++ak+l+ ++laii+K+R+ k+ lcl|FitnessBrowser__Dyella79:N515DRAFT_3805 140 QGFFDIPVDNVYASPLLLADIWRNHsMDNLIVVSPDVGGVVRARALAKRLDdADLAIIDKRRP-KA 204 ********************999998*************************9***********.89 PP TIGR01251 197 nevevtnllgdvegkdvvivDDiisTggTlvkaaelLkekGAkkvivaathgvfsgdAlerlaeag 262 n+++v+n++gdv+gk++v+vDDi++T+gTl++aa +Lke+GA+kv+++++h+v+sg A++++++++ lcl|FitnessBrowser__Dyella79:N515DRAFT_3805 205 NVATVMNIIGDVDGKTCVLVDDIVDTAGTLCAAAAALKERGARKVVAYCVHPVLSGAAISNIENSQ 270 9***************************************************************** PP TIGR01251 263 veevivtntilv.ee.kklpkvseisvapliaeaiarihenesvsslf 308 +++++vtnt++ e +++ k++++sva+l+ae+i+ri+ +esvssl+ lcl|FitnessBrowser__Dyella79:N515DRAFT_3805 271 LDQLVVTNTLPLrPEaQACAKIRQLSVAELLAETIRRIAFGESVSSLY 318 ************8556******************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (320 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 7.73 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory