Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate N515DRAFT_2015 N515DRAFT_2015 branched-chain amino acid aminotransferase
Query= reanno::Dyella79:N515DRAFT_2015 (305 letters) >FitnessBrowser__Dyella79:N515DRAFT_2015 Length = 305 Score = 622 bits (1605), Expect = 0.0 Identities = 305/305 (100%), Positives = 305/305 (100%) Query: 1 MAQQYPEWIWQNGQIKPWREATTHVMSHALHYGSSVFEGIRSYATPDGAAIFRLTDHLKR 60 MAQQYPEWIWQNGQIKPWREATTHVMSHALHYGSSVFEGIRSYATPDGAAIFRLTDHLKR Sbjct: 1 MAQQYPEWIWQNGQIKPWREATTHVMSHALHYGSSVFEGIRSYATPDGAAIFRLTDHLKR 60 Query: 61 LYQSAKIYDMVLPYSQDQIAAACRDVIKQNGLGAAYLRPVAYRGLGGFGLSAETPIDVAV 120 LYQSAKIYDMVLPYSQDQIAAACRDVIKQNGLGAAYLRPVAYRGLGGFGLSAETPIDVAV Sbjct: 61 LYQSAKIYDMVLPYSQDQIAAACRDVIKQNGLGAAYLRPVAYRGLGGFGLSAETPIDVAV 120 Query: 121 AAWPMGPYLGPEALESGIDACVSSWQRFAPNTIPAGAKAGGNYLSGQLIAREARRLGFGE 180 AAWPMGPYLGPEALESGIDACVSSWQRFAPNTIPAGAKAGGNYLSGQLIAREARRLGFGE Sbjct: 121 AAWPMGPYLGPEALESGIDACVSSWQRFAPNTIPAGAKAGGNYLSGQLIAREARRLGFGE 180 Query: 181 GIALANTGLLSEGAGENLFLVFDGVLHTTPASASILTGITRHTLITLAREDGIEVIERDI 240 GIALANTGLLSEGAGENLFLVFDGVLHTTPASASILTGITRHTLITLAREDGIEVIERDI Sbjct: 181 GIALANTGLLSEGAGENLFLVFDGVLHTTPASASILTGITRHTLITLAREDGIEVIERDI 240 Query: 241 PREYLYLCDELLMCGTAAEITPIRSVDGKKIGSGKAGRVTRRMQELFFGLFNGKTNDQWG 300 PREYLYLCDELLMCGTAAEITPIRSVDGKKIGSGKAGRVTRRMQELFFGLFNGKTNDQWG Sbjct: 241 PREYLYLCDELLMCGTAAEITPIRSVDGKKIGSGKAGRVTRRMQELFFGLFNGKTNDQWG 300 Query: 301 WLEPV 305 WLEPV Sbjct: 301 WLEPV 305 Lambda K H 0.320 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 515 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 305 Length adjustment: 27 Effective length of query: 278 Effective length of database: 278 Effective search space: 77284 Effective search space used: 77284 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate N515DRAFT_2015 N515DRAFT_2015 (branched-chain amino acid aminotransferase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.10076.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-120 386.0 0.0 6.4e-120 385.8 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_2015 N515DRAFT_2015 branched-chain am Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_2015 N515DRAFT_2015 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 385.8 0.0 6.4e-120 6.4e-120 1 298 [] 10 305 .] 10 305 .] 0.99 Alignments for each domain: == domain 1 score: 385.8 bits; conditional E-value: 6.4e-120 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglaifrlkehveRlydsakilrleipys 66 w +G++ ++++a++hv++halhYG++vfeGiR+Y t++g+aifrl++h++Rly+saki+++ +pys lcl|FitnessBrowser__Dyella79:N515DRAFT_2015 10 WQNGQIKPWREATTHVMSHALHYGSSVFEGIRSYATPDGAAIFRLTDHLKRLYQSAKIYDMVLPYS 75 89**************************************************************** PP TIGR01122 67 keelvevtkevlrknnlksaYiRplvyvGaedlglkpkvdlkveviiaawewgaylgeealekGik 132 ++++ ++++v+++n+l aY+Rp++y+G +++gl++ +++++v++aaw++g ylg eale+Gi+ lcl|FitnessBrowser__Dyella79:N515DRAFT_2015 76 QDQIAAACRDVIKQNGLGAAYLRPVAYRGLGGFGLSA--ETPIDVAVAAWPMGPYLGPEALESGID 139 ************************************9..889************************ PP TIGR01122 133 vkvssfrraavnsiptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgv 198 + vss++r a+n+ip+ aka+gnYl+ +l+ ea+r G+ e+i+L + G ++eG+Gen+f+v dgv lcl|FitnessBrowser__Dyella79:N515DRAFT_2015 140 ACVSSWQRFAPNTIPAGAKAGGNYLSGQLIAREARRLGFGEGIALANTGLLSEGAGENLFLVFDGV 205 ****************************************************************** PP TIGR01122 199 lltPpvsesiLkgitrdaviklakelgievkeerisreelytaDevfltGtaaevtPirevDgrki 264 l t p s siL+gitr ++i+la+e giev e+ i re ly+ De+ + Gtaae+tPir+vDg+ki lcl|FitnessBrowser__Dyella79:N515DRAFT_2015 206 LHTTPASASILTGITRHTLITLAREDGIEVIERDIPREYLYLCDELLMCGTAAEITPIRSVDGKKI 271 ****************************************************************** PP TIGR01122 265 gegkrGpvtkklqeaffdlvegktekkeewltyv 298 g+gk+G vt+++qe ff l++gkt+++++wl++v lcl|FitnessBrowser__Dyella79:N515DRAFT_2015 272 GSGKAGRVTRRMQELFFGLFNGKTNDQWGWLEPV 305 *******************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (305 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.08 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory