Align 3-isopropylmalate dehydrogenase; 3-IPM-DH; Beta-IPM dehydrogenase; IMDH; EC 1.1.1.85 (characterized)
to candidate N515DRAFT_0570 N515DRAFT_0570 3-isopropylmalate dehydrogenase
Query= SwissProt::P12010 (366 letters) >FitnessBrowser__Dyella79:N515DRAFT_0570 Length = 365 Score = 362 bits (929), Expect = e-105 Identities = 183/365 (50%), Positives = 247/365 (67%), Gaps = 8/365 (2%) Query: 1 MKMKLAVLPGDGIGPEVMDAAIRVLKTVLDNDGHEAVFENALIGGAAIDEAGTPLPEETL 60 MK ++ LPGDG+GPEV AA+ VL V + H +E LIGG AID G PLP + L Sbjct: 1 MKARIVTLPGDGVGPEVTAAAVAVLDAVAAHYDHTFDYEQHLIGGCAIDATGEPLPADAL 60 Query: 61 DICRRSDAILLGAVGGPKWDHNPASLRPEKGLLGLRKEMGLFANLRPVKAYATLLNASPL 120 C+ +DA+LLGAVGGPKW A +RPE+GLL LR +G++ANLRP++ + L SPL Sbjct: 61 AACKSADAVLLGAVGGPKWSDPSAPVRPEQGLLALRAALGVYANLRPLQVHPALTALSPL 120 Query: 121 KRERVENVDLVIVRELTGGLYFGRPSERRGPGENEVVDTLAYTREEIERIIEKAFQLAQI 180 K +++ NVD++ VRELTGG YFG + + D YT E+ER++ +AF+LA+ Sbjct: 121 KDDKLRNVDVLFVRELTGGAYFGAKTRT----VDTATDECKYTVVEVERVVRRAFELARG 176 Query: 181 RRKKLASVDKANVLESSRMWREIAEETAKKYPDVELSHMLVDSTSMQLIANPGQFDVIVT 240 RR K+ SVDKANVLE+SR+WR + A YPDV+L H LVDS +M L+ P +DV+VT Sbjct: 177 RRHKVTSVDKANVLETSRLWRSTVQRIAADYPDVKLEHQLVDSMAMLLLTQPASYDVVVT 236 Query: 241 ENMFGDILSDEASVITGSLGMLPSASLRSDRFGMYEPVHGSAPDIAGQGKANPLGTVLSA 300 EN+FGDIL+DEA+ + GSLG+LPSASL G+YEP+HGSAPDIAG+G ANP+G +LSA Sbjct: 237 ENLFGDILTDEAAALAGSLGLLPSASLGEGARGLYEPIHGSAPDIAGKGVANPVGAILSA 296 Query: 301 ALMLRYSFGLEKEAAAIEKAVDDVLQDGYCTGDLQVANGKVVSTIELTDRLIEKLNNSAA 360 A++LR+S GLE+EA A+E AV+ VL+ G + D+ G T + + ++ L+ A Sbjct: 297 AMLLRHSLGLEEEAGAVEAAVEHVLEHGPRSRDI----GGDAGTAAIREAVVAALDEHVA 352 Query: 361 RPRIF 365 F Sbjct: 353 NSEAF 357 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 365 Length adjustment: 30 Effective length of query: 336 Effective length of database: 335 Effective search space: 112560 Effective search space used: 112560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate N515DRAFT_0570 N515DRAFT_0570 (3-isopropylmalate dehydrogenase)
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00169.hmm # target sequence database: /tmp/gapView.24235.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00169 [M=349] Accession: TIGR00169 Description: leuB: 3-isopropylmalate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-150 485.5 0.0 5e-150 485.3 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_0570 N515DRAFT_0570 3-isopropylmalate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_0570 N515DRAFT_0570 3-isopropylmalate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 485.3 0.0 5e-150 5e-150 1 346 [. 4 344 .. 4 347 .. 0.98 Alignments for each domain: == domain 1 score: 485.3 bits; conditional E-value: 5e-150 TIGR00169 1 kiavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeadav 66 +i+ LpGDg+Gpev+a+a++vL+av+ ++++ +++e++liGG aidatgePlp+++l+ack+adav lcl|FitnessBrowser__Dyella79:N515DRAFT_0570 4 RIVTLPGDGVGPEVTAAAVAVLDAVAAHYDHTFDYEQHLIGGCAIDATGEPLPADALAACKSADAV 69 699*************************************************************** PP TIGR00169 67 LlgavGGpkWdnlprdvrPekgLLklrkeldlfanLrPaklfksLeklsplkeeivkgvDlvvvre 132 LlgavGGpkW + + vrPe+gLL+lr l+++anLrP +++++L++lsplk++ ++vD++ vre lcl|FitnessBrowser__Dyella79:N515DRAFT_0570 70 LLGAVGGPKWSDPSAPVRPEQGLLALRAALGVYANLRPLQVHPALTALSPLKDDKLRNVDVLFVRE 135 ****************************************************************** PP TIGR00169 133 LtgGiYfGepkereeaeeekkaldtekYtkeeieriarvafelarkrrkkvtsvDkanvLessrlW 198 LtgG YfG ++ + + +a d kYt+ e+er++r afelar rr+kvtsvDkanvLe+srlW lcl|FitnessBrowser__Dyella79:N515DRAFT_0570 136 LTGGAYFGAKTRTVD-----TATDECKYTVVEVERVVRRAFELARGRRHKVTSVDKANVLETSRLW 196 ********9988777.....7********************************************* PP TIGR00169 199 rktveeiakeyPdvelehlyiDnaamqLvksPeqldvvvtsnlfGDilsDeasvitGslGlLPsas 264 r tv+ ia +yPdv+leh+++D++am L+ +P+++dvvvt+nlfGDil Dea+ ++GslGlLPsas lcl|FitnessBrowser__Dyella79:N515DRAFT_0570 197 RSTVQRIAADYPDVKLEHQLVDSMAMLLLTQPASYDVVVTENLFGDILTDEAAALAGSLGLLPSAS 262 ****************************************************************** PP TIGR00169 265 lsskglalfepvhgsapdiagkgianpiaailsaalllryslnleeaaeaieaavkkvleegkrte 330 l++ +l+ep+hgsapdiagkg+anp++ailsaa+llr+sl+lee+a a+eaav++vle+g r++ lcl|FitnessBrowser__Dyella79:N515DRAFT_0570 263 LGEGARGLYEPIHGSAPDIAGKGVANPVGAILSAAMLLRHSLGLEEEAGAVEAAVEHVLEHGPRSR 328 ****************************************************************** PP TIGR00169 331 dlaseattavstkeve 346 d++++a+ta++ ++v+ lcl|FitnessBrowser__Dyella79:N515DRAFT_0570 329 DIGGDAGTAAIREAVV 344 *******999998886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (365 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.75 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory