Align Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 (characterized)
to candidate N515DRAFT_4362 N515DRAFT_4362 homoserine O-acetyltransferase
Query= SwissProt::Q8P6V8 (369 letters) >FitnessBrowser__Dyella79:N515DRAFT_4362 Length = 339 Score = 253 bits (645), Expect = 7e-72 Identities = 149/333 (44%), Positives = 190/333 (57%), Gaps = 15/333 (4%) Query: 44 PAADSDAPPAVRGELVINLPMRHAGQR------------ELRLRYELVGAEQAPVVFVAG 91 P + AP V G + ++L + + +R E+ +RY GA AP V V G Sbjct: 7 PVTSASAPCTVAGAVRVDLTTQRSSRRIRLSPKYGSRPCEVDVRYLWCGAPDAPTVIVQG 66 Query: 92 GISAHRHLAASAVFPEKGWVEGLVGAGRALDPASRRLLAFDFLGADGSLDAP--IDTADQ 149 GISA+R + A GW + VGAGR +D R+L D+L LD + + DQ Sbjct: 67 GISANREVVALDDEATPGWWQEAVGAGRPIDLDRYRVLCIDWL-TPAELDGATAVSSEDQ 125 Query: 150 ADAIAALLDALGIARLHGFVGYSYGALVGLQFASRHAARLHTLVAVSGAHRAHPYAAAWR 209 ADA+AAL++ALGIAR+H F+G SYGA+ GL FA+RH L LV ++GAHR HP A A R Sbjct: 126 ADALAALVEALGIARVHAFIGSSYGAMAGLAFAARHPYALDRLVLLAGAHRPHPLATAQR 185 Query: 210 ALQRRAVALGQLQCAEHHGLALARQFAMLSYRTPEEFSERFDAPPELINGRVRVAAEDYL 269 A+QR V LG L+LARQ AM +YR EEFS RF A PE GR EDYL Sbjct: 186 AVQRGIVRLGVETGQPEQALSLARQLAMTTYRGSEEFSRRFTAAPEFREGRFHFPVEDYL 245 Query: 270 DAAGAQYVARTPVNAYLRLSESIDLHRIDPAAVAVPTVVVAVEGDRLVPLADLVSLVEGL 329 G ++V R V +L LSESIDLH + P +A P ++ DRLVPL+DL L L Sbjct: 246 VHQGRRFVERFDVERFLALSESIDLHDVTPERIAAPATLIGFPSDRLVPLSDLCELQRRL 305 Query: 330 GPRGSLRVLRSPFGHDAFLKEIDRIDAILTTAL 362 +L VL SP+GHDAFLKE R+ +L AL Sbjct: 306 HGPATLEVLESPYGHDAFLKETHRLAPLLRDAL 338 Lambda K H 0.321 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 339 Length adjustment: 29 Effective length of query: 340 Effective length of database: 310 Effective search space: 105400 Effective search space used: 105400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory