Align Phosphoserine phosphatase; PSP; EC 3.1.3.3 (characterized)
to candidate N515DRAFT_0640 N515DRAFT_0640 putative hydrolase of the HAD superfamily
Query= SwissProt::Q72H00 (249 letters) >FitnessBrowser__Dyella79:N515DRAFT_0640 Length = 233 Score = 82.0 bits (201), Expect = 1e-20 Identities = 75/243 (30%), Positives = 108/243 (44%), Gaps = 29/243 (11%) Query: 1 MKLLLLDLDDTLLQDLPVSRAVLEDLGRKAGVEGFFARVKARAEALFREAPFYP-WAEAI 59 ++ L LDLDDTL LP ++L +A R+ YP A A Sbjct: 7 IRALTLDLDDTLWPVLPALERADQEL-----------------DAYLRQ--HYPDVARAW 47 Query: 60 GHSALEALWARYSTPGLEALAAWAGPFRERVFREALEEAGGAPERARELAEAFFRERRRY 119 A+ AL A+ + L+ + R + A G A L + +F R Sbjct: 48 PIPAMRALRAQVAGERLDLAHDFTAQ-RHITMQRAFAACGLAEAPLDVLWDIYFTARNSV 106 Query: 120 PLYPEAEAFLAEARRRGLALALLTNGVPDLQREKLVGAGLAHHFSLVLISGEVGIGKPDP 179 LY ++ L +A LTNG DL G+ HF+ + + + G+ KPDP Sbjct: 107 ELYADSLPALQRITAV-FPVASLTNGNADLDM-----IGIRAHFAHHICARDTGVAKPDP 160 Query: 180 RLFRMALCAFGVAPEEAAMVGDNPQKDVRGARLAGVRAVWV--DRGLRPEDPEASPDLRV 237 R+F MA G+AP E VGD+P DV GAR AG+R W+ +R PE A+P+L + Sbjct: 161 RIFSMAAERLGIAPGEILHVGDDPVLDVAGAREAGLRTAWINRERVAWPEALGAAPELDL 220 Query: 238 GDL 240 D+ Sbjct: 221 ADM 223 Lambda K H 0.322 0.140 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 233 Length adjustment: 23 Effective length of query: 226 Effective length of database: 210 Effective search space: 47460 Effective search space used: 47460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory