Align Acetolactate synthase small subunit; Short=AHAS; Short=ALS; EC 2.2.1.6 (characterized, see rationale)
to candidate N515DRAFT_0566 N515DRAFT_0566 acetolactate synthase, small subunit
Query= uniprot:A0A154R0Y7 (82 letters) >FitnessBrowser__Dyella79:N515DRAFT_0566 Length = 82 Score = 114 bits (286), Expect = 2e-31 Identities = 57/78 (73%), Positives = 70/78 (89%) Query: 1 MNHTLSILLQNEAGALVRVAGLFAARGYNIDTLTVAATHDPAVSRLTLSLQCDEAALGQI 60 M HTLSILLQNEAGALVRVAGLF+ARG+NID+LTVAAT DPAVS+LTL + + A+ Q+ Sbjct: 1 MKHTLSILLQNEAGALVRVAGLFSARGFNIDSLTVAATQDPAVSQLTLVMHGADEAVDQL 60 Query: 61 LQQTRKLVDVLQVAHPAA 78 ++QTRKLVDV++V+HPAA Sbjct: 61 IKQTRKLVDVIEVSHPAA 78 Lambda K H 0.321 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 53 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 82 Length of database: 82 Length adjustment: 8 Effective length of query: 74 Effective length of database: 74 Effective search space: 5476 Effective search space used: 5476 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (20.5 bits) S2: 38 (19.2 bits)
Align candidate N515DRAFT_0566 N515DRAFT_0566 (acetolactate synthase, small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00119.hmm # target sequence database: /tmp/gapView.4501.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00119 [M=158] Accession: TIGR00119 Description: acolac_sm: acetolactate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-32 96.7 0.1 7.6e-32 96.5 0.1 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_0566 N515DRAFT_0566 acetolactate synt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_0566 N515DRAFT_0566 acetolactate synthase, small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.5 0.1 7.6e-32 7.6e-32 1 75 [. 1 75 [. 1 81 [. 0.97 Alignments for each domain: == domain 1 score: 96.5 bits; conditional E-value: 7.6e-32 TIGR00119 1 kkhvlsvlvenepGvLsrvsGlfarrgfniesltvgeteekdlsrmtivvegddkvveqiekqleklv 68 +kh+ls+l++ne+G+L rv+Glf++rgfni+sltv+ t+++ +s++t+v++g d++v+q++kq +klv lcl|FitnessBrowser__Dyella79:N515DRAFT_0566 1 MKHTLSILLQNEAGALVRVAGLFSARGFNIDSLTVAATQDPAVSQLTLVMHGADEAVDQLIKQTRKLV 68 79****************************************************************** PP TIGR00119 69 dvlkvld 75 dv++v+ lcl|FitnessBrowser__Dyella79:N515DRAFT_0566 69 DVIEVSH 75 ****986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (158 nodes) Target sequences: 1 (82 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 3.83 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory