GapMind for Amino acid biosynthesis

 

Alignments for a candidate for ilvH in Dyella japonica UNC79MFTsu3.2

Align Acetolactate synthase small subunit; Short=AHAS; Short=ALS; EC 2.2.1.6 (characterized, see rationale)
to candidate N515DRAFT_0566 N515DRAFT_0566 acetolactate synthase, small subunit

Query= uniprot:A0A154R0Y7
         (82 letters)



>FitnessBrowser__Dyella79:N515DRAFT_0566
          Length = 82

 Score =  114 bits (286), Expect = 2e-31
 Identities = 57/78 (73%), Positives = 70/78 (89%)

Query: 1  MNHTLSILLQNEAGALVRVAGLFAARGYNIDTLTVAATHDPAVSRLTLSLQCDEAALGQI 60
          M HTLSILLQNEAGALVRVAGLF+ARG+NID+LTVAAT DPAVS+LTL +   + A+ Q+
Sbjct: 1  MKHTLSILLQNEAGALVRVAGLFSARGFNIDSLTVAATQDPAVSQLTLVMHGADEAVDQL 60

Query: 61 LQQTRKLVDVLQVAHPAA 78
          ++QTRKLVDV++V+HPAA
Sbjct: 61 IKQTRKLVDVIEVSHPAA 78


Lambda     K      H
   0.321    0.130    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 53
Number of extensions: 1
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 82
Length of database: 82
Length adjustment: 8
Effective length of query: 74
Effective length of database: 74
Effective search space:     5476
Effective search space used:     5476
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 38 (20.5 bits)
S2: 38 (19.2 bits)

Align candidate N515DRAFT_0566 N515DRAFT_0566 (acetolactate synthase, small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00119.hmm
# target sequence database:        /tmp/gapView.4501.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00119  [M=158]
Accession:   TIGR00119
Description: acolac_sm: acetolactate synthase, small subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
      7e-32   96.7   0.1    7.6e-32   96.5   0.1    1.0  1  lcl|FitnessBrowser__Dyella79:N515DRAFT_0566  N515DRAFT_0566 acetolactate synt


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Dyella79:N515DRAFT_0566  N515DRAFT_0566 acetolactate synthase, small subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   96.5   0.1   7.6e-32   7.6e-32       1      75 [.       1      75 [.       1      81 [. 0.97

  Alignments for each domain:
  == domain 1  score: 96.5 bits;  conditional E-value: 7.6e-32
                                    TIGR00119  1 kkhvlsvlvenepGvLsrvsGlfarrgfniesltvgeteekdlsrmtivvegddkvveqiekqleklv 68
                                                 +kh+ls+l++ne+G+L rv+Glf++rgfni+sltv+ t+++ +s++t+v++g d++v+q++kq +klv
  lcl|FitnessBrowser__Dyella79:N515DRAFT_0566  1 MKHTLSILLQNEAGALVRVAGLFSARGFNIDSLTVAATQDPAVSQLTLVMHGADEAVDQLIKQTRKLV 68
                                                 79****************************************************************** PP

                                    TIGR00119 69 dvlkvld 75
                                                 dv++v+ 
  lcl|FitnessBrowser__Dyella79:N515DRAFT_0566 69 DVIEVSH 75
                                                 ****986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (158 nodes)
Target sequences:                          1  (82 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 3.83
//
[ok]

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory