Align 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 (characterized)
to candidate HSERO_RS20920 HSERO_RS20920 3-dehydroquinate synthase
Query= SwissProt::U3KRF2 (445 letters) >FitnessBrowser__HerbieS:HSERO_RS20920 Length = 596 Score = 406 bits (1044), Expect = e-118 Identities = 211/380 (55%), Positives = 275/380 (72%), Gaps = 6/380 (1%) Query: 48 SSSNVGRTRLMRASASSTAPVMDTSPTKAVSSAPTIVDVDLGDRSYPIYIGSGLLDQPDL 107 S+S+ +T ASA T M+ + A AP ++VDLG+RSYPI+IG GLLD L Sbjct: 206 STSHTSQTFHGAASAEPTLARMNQNTASA--PAPITLNVDLGERSYPIHIGRGLLDDAGL 263 Query: 108 LQRHVHGKRVLVVTNSTVAPIYLDKVVGALTNGNPNVSVESVILPDGEKYKNMDTLMKVF 167 L ++V GKRV +VTN V P+YLDKV L V+ ++LPDGE+ KN +LMK+F Sbjct: 264 LPQYVKGKRVAIVTNDKVGPLYLDKVAQPLRAAGKLVT--EIVLPDGEEEKNWASLMKIF 321 Query: 168 DKAIESRLDRRCTFVALGGGVIGDMCGYAAASFLRGVNFIQIPTTVMAQVDSSVGGKTGI 227 D+ + + DR+ T +ALGGGVIGD+ G+AAAS++RGV F+Q+PTT+++QVDSSVGGKTGI Sbjct: 322 DRLLADKCDRKTTLIALGGGVIGDLTGFAAASYMRGVPFVQVPTTLLSQVDSSVGGKTGI 381 Query: 228 NHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASGLAEVVKYGLIRDANFFEWQEKNMP 287 NH LGKN+IGAFYQPQ V+ DT TL+TLP REL++G+AEV+K+G I DA FF+W E N+ Sbjct: 382 NHPLGKNMIGAFYQPQAVIADTATLHTLPPRELSAGIAEVIKHGAIIDAPFFDWIETNIA 441 Query: 288 ALMARDPSALAYAIKRSCENKAEVVSLDEKESGLRATLNLGHTFGHAIETGFGYGQWLHG 347 L+++D +ALAYAI+RSCE KAEVV DE+E GLRA LN GHTFGHAIE G GYGQWLHG Sbjct: 442 QLVSKDDAALAYAIQRSCEIKAEVVRQDEREGGLRAILNFGHTFGHAIENGLGYGQWLHG 501 Query: 348 EAVAAGMVMAVDMSYRLGWIDESIVNRAHNILQQAKLPTAPPETMTVEMFKSVMAVDKKV 407 EAV GMVMA D+S+RLG+ID +R + A LPT P+ + V + +M VDKK Sbjct: 502 EAVGCGMVMAADLSHRLGYIDAGARDRVRALTAAAGLPTVAPD-LGVARWLELMEVDKKN 560 Query: 408 ADGLLRLILLKGPLGNCVFT 427 G ++ IL++ PLG+ + T Sbjct: 561 EGGQIKFILIR-PLGSPLIT 579 Lambda K H 0.318 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 599 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 596 Length adjustment: 35 Effective length of query: 410 Effective length of database: 561 Effective search space: 230010 Effective search space used: 230010 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
Align candidate HSERO_RS20920 HSERO_RS20920 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.20109.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-124 401.3 0.0 2.9e-124 400.7 0.0 1.3 1 lcl|FitnessBrowser__HerbieS:HSERO_RS20920 HSERO_RS20920 3-dehydroquinate s Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS20920 HSERO_RS20920 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 400.7 0.0 2.9e-124 2.9e-124 1 342 [. 249 589 .. 249 591 .. 0.96 Alignments for each domain: == domain 1 score: 400.7 bits; conditional E-value: 2.9e-124 TIGR01357 1 ykvkvgegllkklveelae.kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKslet 67 y++++g+gll+ + + k +++ ++t+++v l+ +k+++ l+++g v+++v+pdgee K++++ lcl|FitnessBrowser__HerbieS:HSERO_RS20920 249 YPIHIGRGLLDDAGLLPQYvKGKRVAIVTNDKVGPLYLDKVAQPLRAAGKLVTEIVLPDGEEEKNWAS 316 68999****99665444434569********************************************* PP TIGR01357 68 vaklldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlp 135 + k+ d+ll+ k++rk++l+a+GGGv+gDl+GF+Aa+y+RG+++vqvPTtll++vDssvGGKtgin+p lcl|FitnessBrowser__HerbieS:HSERO_RS20920 317 LMKIFDRLLADKCDRKTTLIALGGGVIGDLTGFAAASYMRGVPFVQVPTTLLSQVDSSVGGKTGINHP 384 ******************************************************************** PP TIGR01357 136 lgkNliGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaeleal 203 lgkN+iGafyqP+aV+ d+++l+tlp rel++G+aEviKhg+i da +f+++e+n ++l+++ + +al lcl|FitnessBrowser__HerbieS:HSERO_RS20920 385 LGKNMIGAFYQPQAVIADTATLHTLPPRELSAGIAEVIKHGAIIDAPFFDWIETNIAQLVSK-DDAAL 451 ********************************************************998875.559** PP TIGR01357 204 eelikrsievKaevVeeDekesglRalLNfGHtlgHaiEallkyk.lsHGeaVaiGmvveaklseklg 270 + +i+rs+e+KaevV +De+e glRa+LNfGHt+gHaiE+ l+y+ + HGeaV +Gmv++a ls++lg lcl|FitnessBrowser__HerbieS:HSERO_RS20920 452 AYAIQRSCEIKAEVVRQDEREGGLRAILNFGHTFGHAIENGLGYGqWLHGEAVGCGMVMAADLSHRLG 519 ********************************************99********************** PP TIGR01357 271 llkaellerlvallkklglptklkkklsveellkallkDKKnegskiklvlleeiGkaalasevteee 338 +++a ++r++al+ ++glpt ++ l v l+ + DKKneg++ik++l++ +G++ ++ +v+++ lcl|FitnessBrowser__HerbieS:HSERO_RS20920 520 YIDAGARDRVRALTAAAGLPTVAPD-LGVARWLELMEVDKKNEGGQIKFILIRPLGSPLIT-NVPQDL 585 ***********************97.********************************999.888887 PP TIGR01357 339 llea 342 ll++ lcl|FitnessBrowser__HerbieS:HSERO_RS20920 586 LLQT 589 7765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (596 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.76 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory