Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate 370251 SO3078.2 hypothetical chorismate synthase (NCBI ptt file)
Query= SwissProt::P12008 (361 letters) >FitnessBrowser__MR1:370251 Length = 261 Score = 410 bits (1053), Expect = e-119 Identities = 201/258 (77%), Positives = 226/258 (87%) Query: 1 MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60 M+GN+IGQ F VTTFGESHG+ALGCI+DG PPG+ LTEAD+QHDLDRRRPGTSRYTT RR Sbjct: 1 MSGNSIGQNFVVTTFGESHGVALGCIIDGCPPGLELTEADMQHDLDRRRPGTSRYTTARR 60 Query: 61 EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY 120 EPD+V+ILSGVFEG TTGTSIGLLIENTDQRSQDYS IKD+FRPGHADYTY+QKYGLRDY Sbjct: 61 EPDEVRILSGVFEGKTTGTSIGLLIENTDQRSQDYSNIKDLFRPGHADYTYQQKYGLRDY 120 Query: 121 RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIKDWSQVEQNPFFC 180 RGGGRSSARETAMRVAAGA+AKKYL + GI I+G ++Q+G I + D+SQ+EQN FF Sbjct: 121 RGGGRSSARETAMRVAAGAVAKKYLKQVHGISIQGYMSQLGPICAETLDFSQIEQNAFFF 180 Query: 181 PDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSINAV 240 PD K++ALDE MR LKK GDSIGAK++VVA+ VP GLGEPVFDRLDADIAHALM INAV Sbjct: 181 PDASKLEALDEYMRELKKSGDSIGAKISVVATNVPVGLGEPVFDRLDADIAHALMGINAV 240 Query: 241 KGVEIGDGFDVVALRGSQ 258 KGVEIGDGF VV R + Sbjct: 241 KGVEIGDGFGVVTQRAQK 258 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 261 Length adjustment: 27 Effective length of query: 334 Effective length of database: 234 Effective search space: 78156 Effective search space used: 78156 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate 370251 SO3078.2 (hypothetical chorismate synthase (NCBI ptt file))
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.29550.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-109 351.3 0.1 3.3e-109 351.0 0.1 1.0 1 lcl|FitnessBrowser__MR1:370251 SO3078.2 hypothetical chorismate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:370251 SO3078.2 hypothetical chorismate synthase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 351.0 0.1 3.3e-109 3.3e-109 1 251 [. 10 255 .. 10 259 .. 0.97 Alignments for each domain: == domain 1 score: 351.0 bits; conditional E-value: 3.3e-109 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtGaPiallikNk 79 + +ttfGeSHg alg+iidG+P+glelte+d+q++l+rRrpg+sr+t+ r+E Dev+ilsGvfeGkTtG+ i lli+N+ lcl|FitnessBrowser__MR1:370251 10 FVVTTFGESHGVALGCIIDGCPPGLELTEADMQHDLDRRRPGTSRYTTARREPDEVRILSGVFEGKTTGTSIGLLIENT 88 569**************************************************************************** PP TIGR00033 80 dvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLketagieivayvvklgevelee 158 d+rs+dy++ik+l+RPgHadyty++KYg++d++gggrsSaReTa+rvaaGavakk+Lk+ +gi i +y+++lg +++e+ lcl|FitnessBrowser__MR1:370251 89 DQRSQDYSNIKDLFRPGHADYTYQQKYGLRDYRGGGRSSARETAMRVAAGAVAKKYLKQVHGISIQGYMSQLGPICAET 167 ****************************************************************************997 PP TIGR00033 159 esakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvvsnvpvglGeplfdkldaelasallsinAvK 237 + +++++ +++pda++ +++ e++ ++kk+gds+G++++vv++nvpvglGep+fd+lda +a+al++inAvK lcl|FitnessBrowser__MR1:370251 168 LDF-----SQIEQNAFFFPDASKLEALDEYMRELKKSGDSIGAKISVVATNVPVGLGEPVFDRLDADIAHALMGINAVK 241 444.....5799******************************************************************* PP TIGR00033 238 gveiGdGFeaasvr 251 gveiGdGF +++r lcl|FitnessBrowser__MR1:370251 242 GVEIGDGFGVVTQR 255 ********988765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (261 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.03 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory