Align S-sulfo-L-cysteine synthase (O-acetyl-L-serine-dependent) (EC 2.5.1.144); cysteine synthase (EC 2.5.1.47) (characterized)
to candidate 202695 SO3598 cysteine synthase B (NCBI ptt file)
Query= BRENDA::P29848 (303 letters) >FitnessBrowser__MR1:202695 Length = 288 Score = 378 bits (971), Expect = e-110 Identities = 195/291 (67%), Positives = 234/291 (80%), Gaps = 6/291 (2%) Query: 3 TLEQTIGNTPLVKLQRLGPDNGSE-IWVKLEGNNPAGSVKDRAALSMIVEAEKRGEIKPG 61 T+E IG TPLV+LQRL D GS + +KLEGNNPAGSVKDRAAL+MI +AE R EI PG Sbjct: 2 TIEACIGQTPLVRLQRL--DCGSSTVLLKLEGNNPAGSVKDRAALNMINQAELRQEIAPG 59 Query: 62 DVLIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRAAMRAYGAELILVTKEQGMEG 121 D LIEATSGNTGIALAM AA+KGY+M L+MP N +QER+ AM+AYGAEL+LV ME Sbjct: 60 DTLIEATSGNTGIALAMAAAIKGYKMILIMPSNSTQERKDAMQAYGAELLLV---DNMEA 116 Query: 122 ARDLALAMSERGEGKLLDQFNNPDNPYAHYTTTGPEIWRQTSGRITHFVSSMGTTGTITG 181 ARDLALA+ G+GK+LDQFNN DN AH+ TTGPEIW+Q+ G+ITHFVSSMGTTGTI G Sbjct: 117 ARDLALALQAEGKGKVLDQFNNQDNANAHFLTTGPEIWQQSQGKITHFVSSMGTTGTIMG 176 Query: 182 VSRFLREQEKPVTIVGLQPEEGSSIPGIRRWPAEYMPGIFNASLVDEVLDIHQNDAENTM 241 VS++L+ + +TIVGLQP +GSSIPGIRRWP EY+PGIF+A+ VD ++DI + DA+ Sbjct: 177 VSKYLKSRNPDITIVGLQPADGSSIPGIRRWPQEYLPGIFDAARVDLMMDIEEQDAKAMA 236 Query: 242 RELAVREGIFCGVSSGGAVAGALRVARATPGAIVVAIICDRGDRYLSTGVF 292 R LA EGI GVSSGGAV AL +AR PG++VVAI+CDRGDRYLS+G+F Sbjct: 237 RALAREEGICAGVSSGGAVYAALELARQYPGSVVVAIVCDRGDRYLSSGLF 287 Lambda K H 0.316 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 328 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 288 Length adjustment: 26 Effective length of query: 277 Effective length of database: 262 Effective search space: 72574 Effective search space used: 72574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate 202695 SO3598 (cysteine synthase B (NCBI ptt file))
to HMM TIGR01138 (cysM: cysteine synthase B (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01138.hmm # target sequence database: /tmp/gapView.21101.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01138 [M=290] Accession: TIGR01138 Description: cysM: cysteine synthase B Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-142 458.5 0.1 6e-142 458.3 0.1 1.0 1 lcl|FitnessBrowser__MR1:202695 SO3598 cysteine synthase B (NCBI Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:202695 SO3598 cysteine synthase B (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 458.3 0.1 6e-142 6e-142 1 290 [] 2 287 .. 2 287 .. 0.99 Alignments for each domain: == domain 1 score: 458.3 bits; conditional E-value: 6e-142 TIGR01138 1 tilklvGntplvrlkrllpeedsevlvklegnnpaGsvkdrpalsmiveaekrGeikeGdvlieatsGntGialamvaa 79 ti+ ++G tplvrl+rl +s+vl+klegnnpaGsvkdr+al mi +ae+r ei +Gd+lieatsGntGialam+aa lcl|FitnessBrowser__MR1:202695 2 TIEACIGQTPLVRLQRLDCG-SSTVLLKLEGNNPAGSVKDRAALNMINQAELRQEIAPGDTLIEATSGNTGIALAMAAA 79 89**************9875.789******************************************************* PP TIGR01138 80 lkGykvkllmpdnvseerkaalkayGaelilvdkeeGmeGardlarelvrkgeeklldqfnnpdnpkahytstGieiwq 158 +kGyk++l+mp+n+++erk a++ayGael+lvd+ me ardla l+ +g++k+ldqfnn dn +ah+ +tG+eiwq lcl|FitnessBrowser__MR1:202695 80 IKGYKMILIMPSNSTQERKDAMQAYGAELLLVDN---MEAARDLALALQAEGKGKVLDQFNNQDNANAHFLTTGPEIWQ 155 ********************************86...899*************************************** PP TIGR01138 159 qtkGrithfvsslGttGtimGvsrflkeqnpavqivGlqpaegsaieGlrrieseylpgifdaslvdrvvdveqedaed 237 q++G+ithfvss+GttGtimGvs++lk +np+++ivGlqpa+gs+i+G+rr+++eylpgifda++vd ++d+e++da+ lcl|FitnessBrowser__MR1:202695 156 QSQGKITHFVSSMGTTGTIMGVSKYLKSRNPDITIVGLQPADGSSIPGIRRWPQEYLPGIFDAARVDLMMDIEEQDAKA 234 ******************************************************************************* PP TIGR01138 238 iarelakkegifvGvssGgavaaalrlarelekavvvaiicdrGdrylstgvf 290 +ar la++egi GvssGgav+aal+lar+ + +vvvai+cdrGdryls+g+f lcl|FitnessBrowser__MR1:202695 235 MARALAREEGICAGVSSGGAVYAALELARQYPGSVVVAIVCDRGDRYLSSGLF 287 ***************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (290 nodes) Target sequences: 1 (288 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.26 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory