Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate 200301 SO1121 glutamate 5-kinase (NCBI ptt file)
Query= BRENDA::P0A7B5 (367 letters) >FitnessBrowser__MR1:200301 Length = 372 Score = 443 bits (1139), Expect = e-129 Identities = 228/360 (63%), Positives = 280/360 (77%), Gaps = 1/360 (0%) Query: 7 LVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHLGYPELP 66 +VVKLGTSVLT GS++L++AH+VEL RQ A L +G +V+ TSGAIAAGREHL YP LP Sbjct: 11 VVVKLGTSVLTSGSKQLDKAHMVELARQMAALMRSGVEVVLCTSGAIAAGREHLQYPALP 70 Query: 67 ATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDTLRALLD 126 T+A+KQLLAAVGQS+LI W QLFSIYG+HVGQ+LLTRAD+ DRER+LNARDTL ALL Sbjct: 71 DTMANKQLLAAVGQSQLILAWAQLFSIYGLHVGQLLLTRADLHDRERYLNARDTLNALLA 130 Query: 127 NNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPRSNPQAE 186 NNI+P+INENDAVAT EIKVGDNDNLSA AA+L AD L+LLTDQKGL+ ADPR+NP A+ Sbjct: 131 NNIIPIINENDAVATNEIKVGDNDNLSARAALLCDADLLILLTDQKGLFDADPRTNPNAK 190 Query: 187 LIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPGVIGDVM 246 LI V IDD+LR +AG SVSGLGTGGMSTKL+AAD+A RAGI+ +IA+G P VI V+ Sbjct: 191 LISQVEKIDDSLRLLAGGSVSGLGTGGMSTKLEAADIARRAGIEVVIASGHHPDVIKKVV 250 Query: 247 EGISVGTLFHAQATPLENRKRWIFGAPPA-GEITVDEGATAAILERGSSLLPKGIKSVTG 305 S+GT F A PLE+RK+WI P A G + +D GA A+ E+G SLL KGI V G Sbjct: 251 AKESIGTHFSAIENPLESRKQWILAGPAAQGSLVLDAGAVKAVTEKGRSLLSKGIIGVKG 310 Query: 306 NFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAVHRDDMI 365 F RG +++ + G+ IA G++RY +AL IAG HS EI+++LGY+YG VHR+DM+ Sbjct: 311 EFERGATLQLVDQNGKIIARGITRYCGEALGLIAGKHSDEIESVLGYDYGDAIVHRNDMV 370 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 403 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 372 Length adjustment: 30 Effective length of query: 337 Effective length of database: 342 Effective search space: 115254 Effective search space used: 115254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate 200301 SO1121 (glutamate 5-kinase (NCBI ptt file))
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.19419.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-147 476.2 3.0 4e-147 476.0 3.0 1.0 1 lcl|FitnessBrowser__MR1:200301 SO1121 glutamate 5-kinase (NCBI Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:200301 SO1121 glutamate 5-kinase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 476.0 3.0 4e-147 4e-147 1 363 [] 9 371 .. 9 371 .. 1.00 Alignments for each domain: == domain 1 score: 476.0 bits; conditional E-value: 4e-147 TIGR01027 1 kriVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkklaekQalaaVGQgrL 79 +r+VvKlG+s+Lt++s++l++++++el++q+a+l++ G evv+ +SGa+aaG e+L +p p ++a+kQ+laaVGQ++L lcl|FitnessBrowser__MR1:200301 9 RRVVVKLGTSVLTSGSKQLDKAHMVELARQMAALMRSGVEVVLCTSGAIAAGREHLQYPALPDTMANKQLLAAVGQSQL 87 59***************************************************************************** PP TIGR01027 80 mklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtvaveeikfGDNDtLsalvaalveA 158 + ++ +lfs+ygl+v+Q+LLtradl++rerylNar+tl++ll+++++pi+NEND+va++eik+GDND+Lsa a l +A lcl|FitnessBrowser__MR1:200301 88 ILAWAQLFSIYGLHVGQLLLTRADLHDRERYLNARDTLNALLANNIIPIINENDAVATNEIKVGDNDNLSARAALLCDA 166 ******************************************************************************* PP TIGR01027 159 dlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgssvGTGGmrtKleaaelAsragveviiasgekpek 237 dlL+lltd++gL+dadprtnp+Akli++ve+i+++l+ +ag+s s +GTGGm+tKleaa++A rag+ev+iasg++p+ lcl|FitnessBrowser__MR1:200301 167 DLLILLTDQKGLFDADPRTNPNAKLISQVEKIDDSLRLLAGGSVSGLGTGGMSTKLEAADIARRAGIEVVIASGHHPDV 245 ******************************************************************************* PP TIGR01027 238 iadlledaavgtlfeakkkklknrkqwilaaseakGkiivdegaeeallekgksLlpagvvevegnFsrgevveilaee 316 i ++++++++gt f a ++ l++rkqwila+++a+G++++d+ga++a++ekg+sLl +g+++v+g+F+rg ++++++++ lcl|FitnessBrowser__MR1:200301 246 IKKVVAKESIGTHFSAIENPLESRKQWILAGPAAQGSLVLDAGAVKAVTEKGRSLLSKGIIGVKGEFERGATLQLVDQN 324 ******************************************************************************* PP TIGR01027 317 gqeigkglvnysseelekikglkseeiedvLgyekkeevvhrdnlvl 363 g++i++g ++y e+l i+g++s+eie vLgy + + +vhr+++v+ lcl|FitnessBrowser__MR1:200301 325 GKIIARGITRYCGEALGLIAGKHSDEIESVLGYDYGDAIVHRNDMVV 371 ********************************************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (372 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.96 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory