Align anthranilate synthase (subunit 2/2) (EC 4.1.3.27) (characterized)
to candidate 199801 SO0613 para-aminobenzoate synthase glutamine amidotransferase, component II (NCBI ptt file)
Query= BRENDA::P20576 (201 letters) >FitnessBrowser__MR1:199801 Length = 191 Score = 238 bits (607), Expect = 5e-68 Identities = 122/192 (63%), Positives = 147/192 (76%), Gaps = 3/192 (1%) Query: 1 MLLMIDNYDSFTYNLVQYFGELKAEVKVVRNDELSVEQIEALAPERIVLSPGPCTPNEAG 60 MLLMIDNYDSFT+NLVQYF +L E+ V RNDE+S+E IEALAP +V+SPGPC+PNEAG Sbjct: 1 MLLMIDNYDSFTFNLVQYFQQLGQEIVVKRNDEISLEGIEALAPSHLVISPGPCSPNEAG 60 Query: 61 VSLAVIERFAGKLPLLGVCLGHQSIGQAFGGEVVRARQVMHGKTSPIHHKDLGVFAGLAN 120 +SLA IE FA +LP+LGVCLGHQ++ Q FG +VVRA++VMHGK S I H +F GL Sbjct: 61 ISLAAIEHFATRLPILGVCLGHQAMAQVFGAKVVRAQRVMHGKVSAIAHTGERLFKGLNQ 120 Query: 121 PLTVTRYHSLVVKRESLPECLEVTAWTQHADGSLDEIMGVRHKTLNVEGVQFHPESILTE 180 PLTVTRYHSL+V +++P+ + AW EIM + HK L + GVQFHPESILTE Sbjct: 121 PLTVTRYHSLLV--DTVPKDFVLDAWFDDPTHG-REIMAMSHKELPLFGVQFHPESILTE 177 Query: 181 QGHELLANFLRQ 192 QGHELLANFL Q Sbjct: 178 QGHELLANFLSQ 189 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 191 Length adjustment: 20 Effective length of query: 181 Effective length of database: 171 Effective search space: 30951 Effective search space used: 30951 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate 199801 SO0613 (para-aminobenzoate synthase glutamine amidotransferase, component II (NCBI ptt file))
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00566.hmm # target sequence database: /tmp/gapView.20932.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00566 [M=192] Accession: TIGR00566 Description: trpG_papA: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-85 272.2 0.0 1.4e-85 272.0 0.0 1.0 1 lcl|FitnessBrowser__MR1:199801 SO0613 para-aminobenzoate syntha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:199801 SO0613 para-aminobenzoate synthase glutamine amidotransferase, component II (NCBI ptt # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 272.0 0.0 1.4e-85 1.4e-85 1 191 [. 1 188 [. 1 189 [. 0.96 Alignments for each domain: == domain 1 score: 272.0 bits; conditional E-value: 1.4e-85 TIGR00566 1 mvllidnydsftynlvqlleelgaevvvkrndsltlqeieallpllsivisPGPctPdeaaissleliehlaGklPilG 79 m+l+idnydsft+nlvq++++lg+e+vvkrnd++ l+ ieal+p + +visPGPc+P+ea+is l++ieh+a +lPilG lcl|FitnessBrowser__MR1:199801 1 MLLMIDNYDSFTFNLVQYFQQLGQEIVVKRNDEISLEGIEALAPSH-LVISPGPCSPNEAGIS-LAAIEHFATRLPILG 77 79********************************************.****************.*************** PP TIGR00566 80 vClGhqalaqafGadvvraekvkhGkvseiehngaavfaglfnPdalkatryhslvveaetldtllevtaleeee...i 155 vClGhqa+aq+fGa+vvra++v+hGkvs+i h g+ +f+gl +P l++tryhsl v+ t+++ + + a+ + + lcl|FitnessBrowser__MR1:199801 78 VCLGHQAMAQVFGAKVVRAQRVMHGKVSAIAHTGERLFKGLNQP--LTVTRYHSLLVD--TVPKDFVLDAWFDDPthgR 152 ********************************************..**********96..6777777777766655589 PP TIGR00566 156 eimairhrdlpleGvqfhPesilselGkellanflk 191 eima+ h++lpl+GvqfhPesil+e+G+ellanfl lcl|FitnessBrowser__MR1:199801 153 EIMAMSHKELPLFGVQFHPESILTEQGHELLANFLS 188 **********************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (192 nodes) Target sequences: 1 (191 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.30 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory