Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (uncharacterized)
to candidate 203782 SO4713 menaquinone-specific isochorismate synthase, putative (NCBI ptt file)
Query= curated2:O28669 (411 letters) >FitnessBrowser__MR1:203782 Length = 452 Score = 117 bits (293), Expect = 7e-31 Identities = 86/261 (32%), Positives = 134/261 (51%), Gaps = 15/261 (5%) Query: 156 FEKMVERGKEQIFEGEVYQIVLSR--EYVVDTDLSPFQMYLNLRETNPSPYMFLLEF--D 211 ++ +VE+ E F + ++VLSR E V+ + P+ + + NP+ + F +F D Sbjct: 191 WKTLVEQVIEPKFNQDTPKVVLSRLTELEVNEQVDPWMVLACWQGRNPNSFQFGFQFSPD 250 Query: 212 RALIGSSPETMGRVEGNSFIINPIAGTARREAGREKEIA--EKLLSDEKERAEHVMLVDL 269 R I SPE + R +AGT R +E+++A LL D K E+ L Sbjct: 251 RTYISCSPERLFRRSQQELFTEALAGTTVRGLNQEEDVALANALLEDNKNSVEN----QL 306 Query: 270 ARNDVRKVCRAGSVRVSRFME--VVEYPSVLHIESEVVGELKAGVTHFDAMKATFPAGTV 327 R + + S V E + + + H+ + ELK GV+ F ++A P V Sbjct: 307 VRRHIVSMLTPLSQYVGAEEEATIFKLNHIQHLHRAIRAELKPGVSDFQLLQALHPTPAV 366 Query: 328 TGAPKLRAIELIDEIEGDCRGVYAGAVGYFSENVSDLAIAIR--MIEFDGKARIRAGAGI 385 G P+ A+ I + EG RG YAGA GYF+++ S+ ++AIR +IE GK + AGAGI Sbjct: 367 GGLPRESAMTFIRQREGYMRGWYAGACGYFNKDESEFSVAIRSALIE-PGKINLFAGAGI 425 Query: 386 VADSVPEREFFETENKIARVL 406 +A S PE E+ E ENK+A ++ Sbjct: 426 IAGSDPEAEWQELENKLATIM 446 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 379 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 411 Length of database: 452 Length adjustment: 32 Effective length of query: 379 Effective length of database: 420 Effective search space: 159180 Effective search space used: 159180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory