Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate 8500660 DvMF_1408 chorismate synthase (RefSeq)
Query= SwissProt::P12008 (361 letters) >FitnessBrowser__Miya:8500660 Length = 353 Score = 366 bits (939), Expect = e-106 Identities = 187/351 (53%), Positives = 241/351 (68%), Gaps = 4/351 (1%) Query: 1 MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYT---T 57 M+GNT G++FR+TT+GESHG LG +VDG P G+PL E+ +Q +LD RRPG++ T Sbjct: 1 MSGNTFGRIFRLTTYGESHGPGLGGVVDGCPAGVPLDESVIQRELDLRRPGSASAGLAGT 60 Query: 58 QRREPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGL 117 R+EPD V++LSGVFEGVTTGT IG I N DQRS+DY + ++RPGHAD TY+ KYGL Sbjct: 61 ARKEPDTVRLLSGVFEGVTTGTPIGFHIANEDQRSRDYGDLAKLYRPGHADITYDAKYGL 120 Query: 118 RDYRGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIKDWSQVEQNP 177 RD+RGGGR+S RET RVA GA+A LA IE+R ++G +P D+ D + + Sbjct: 121 RDFRGGGRASGRETVSRVAGGAVALALLA-MHDIEVRAYTVEIGGVPADVVDPAGAQGRL 179 Query: 178 FFCPDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSI 237 FF PDPD + A + L+ ++ EGD++G V V A+GVPAGLGEPVFD+LDA +AHA+MS+ Sbjct: 180 FFSPDPDVVPAWESLVHDVRAEGDTLGGIVQVEATGVPAGLGEPVFDKLDALLAHAMMSV 239 Query: 238 NAVKGVEIGDGFDVVALRGSQNRDEITKDGFQSNHAGGILGGISSGQQIIAHMALKPTSS 297 AVK VE+G G + LRGS+N D I GF +NHAGGILGGIS+GQ I+ +KP S Sbjct: 240 GAVKAVEVGAGLEAARLRGSENNDPIIPGGFHTNHAGGILGGISNGQPIVVRATVKPIPS 299 Query: 298 ITVPGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQR 348 I TI+ G + GRHD C R VP+ +AM A+VL D LL QR Sbjct: 300 IAQEQITIDTNGRPAPLRVGGRHDICAIPRVVPVLKAMAALVLADSLLLQR 350 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 435 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 353 Length adjustment: 29 Effective length of query: 332 Effective length of database: 324 Effective search space: 107568 Effective search space used: 107568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate 8500660 DvMF_1408 (chorismate synthase (RefSeq))
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.10889.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-121 391.6 0.0 1.7e-121 391.4 0.0 1.0 1 lcl|FitnessBrowser__Miya:8500660 DvMF_1408 chorismate synthase (R Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8500660 DvMF_1408 chorismate synthase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 391.4 0.0 1.7e-121 1.7e-121 1 348 [. 10 350 .. 10 353 .] 0.95 Alignments for each domain: == domain 1 score: 391.4 bits; conditional E-value: 1.7e-121 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsr...ltrmrkEeDeveilsGvfeGkTtGaPial 74 +rltt+GeSHg+ lg ++dG+Pag++l+e+ iq+el+ Rrpg++ + rkE D+v++lsGvfeG TtG+Pi + lcl|FitnessBrowser__Miya:8500660 10 FRLTTYGESHGPGLGGVVDGCPAGVPLDESVIQRELDLRRPGSASaglAGTARKEPDTVRLLSGVFEGVTTGTPIGF 86 89****************************************865222579************************** PP TIGR00033 75 likNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLketagieivayvvkl 151 i N+d+rs+dy d+++l+RPgHad ty KYg++d +gggr+S+ReT+ rva Gava +lL+ ++ie+ ay+v++ lcl|FitnessBrowser__Miya:8500660 87 HIANEDQRSRDYGDLAKLYRPGHADITYDAKYGLRDFRGGGRASGRETVSRVAGGAVALALLAM-HDIEVRAYTVEI 162 ***************************************************************9.66********** PP TIGR00033 152 geveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvvsnvpvglGeplfdkldaelas 228 g v ++ + ++ + ++ pd++ + e +++ ++ +gd++Gg+v+v +++vp+glGep+fdklda la+ lcl|FitnessBrowser__Miya:8500660 163 GGVPADVVD-----PAGAQGRLFFSPDPDVVPAWESLVHDVRAEGDTLGGIVQVEATGVPAGLGEPVFDKLDALLAH 234 **9998533.....44566688999**************************************************** PP TIGR00033 229 allsinAvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGieGGitnGedirvriavKpiptikkplktv 305 a++s+ AvK+ve+G+G eaa+ rGse nD++ ++tn+ GGi+GGi+nG++i+vr++vKpip+i++++ t+ lcl|FitnessBrowser__Miya:8500660 235 AMMSVGAVKAVEVGAGLEAARLRGSENNDPIIP----GGFHTNHAGGILGGISNGQPIVVRATVKPIPSIAQEQITI 307 *****************************9985....4699************************************ PP TIGR00033 306 dletkekakatkgRhDpcvvpravpvvEamvalvladallekr 348 d++++++ + gRhD c++pr+vpv am alvlad ll +r lcl|FitnessBrowser__Miya:8500660 308 DTNGRPAPLRVGGRHDICAIPRVVPVLKAMAALVLADSLLLQR 350 **************************************99776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (353 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.04 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory