Align Aspartate kinase Ask_LysC; Aspartokinase; EC 2.7.2.4 (characterized)
to candidate 8499506 DvMF_0276 aspartate kinase (RefSeq)
Query= SwissProt::A4VJB4 (412 letters) >FitnessBrowser__Miya:8499506 Length = 409 Score = 440 bits (1131), Expect = e-128 Identities = 226/409 (55%), Positives = 305/409 (74%), Gaps = 1/409 (0%) Query: 1 MALIVQKFGGTSVGTVERIEQVAEKVKKFRDGGDDIVVVVSAMSGETNRLIDLAKQISEQ 60 M ++VQKFGGTSV +E ++QV EKV++ G VVV+SA SGETNRL+ LA++ S Sbjct: 1 MRILVQKFGGTSVANLECMKQVREKVRRALRDGYKPVVVLSARSGETNRLLALAEEWSTD 60 Query: 61 PVPRELDVMVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHTKARILQIDAQR 120 P P E+D +++TGEQV++AL +M L G+ A S TG QV I T A +ARI+ IDA R Sbjct: 61 PDPAEVDALIATGEQVSVALFSMLLKDSGIKARSMTGFQVPITTSDAFGRARIMDIDASR 120 Query: 121 IQRDIKAGRVVVVAGFQGVDEKGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT 180 ++++++ V+VVAGFQGV +G +TTLGRGGSDT+ VALAAAL + EC+IYTDVDGVYT Sbjct: 121 LRKELETHDVIVVAGFQGVTSEGRVTTLGRGGSDTSAVALAAALGSVECEIYTDVDGVYT 180 Query: 181 TDPRVVAKAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYSVPLRVLHSFQEGPGTLI 240 TDP + + A++LD+++++EMLEMAS+G+KVLQIR+VEFA KY VP+ V +F + PGT++ Sbjct: 181 TDPNLCSTARKLDRVSYDEMLEMASMGAKVLQIRSVEFAKKYKVPVHVRSTFTDTPGTMV 240 Query: 241 TLDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANVEVDMIVQNVAH 300 T E+ ME ++SGIA+++D+A++T+R VPD PGV+ I GP+S + VDMIVQN + Sbjct: 241 T-QEDCEMEAVLVSGIAYDKDQARVTLRSVPDKPGVSAAIFGPLSQQGILVDMIVQNPSR 299 Query: 301 DNTTDFTFTVHRNDYNNALQVLQGIAAEMGAREAIGDTNIAKVSIVGVGMRSHAGVASRM 360 D TD TFTV R D L +++ I A GA+E + DT +AKVS +GVGMR+H+GVA++ Sbjct: 300 DGVTDMTFTVPRKDLKKTLALMEEIRARTGAQEVLHDTQVAKVSAIGVGMRNHSGVAAKA 359 Query: 361 FEALAKENINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPAGN 409 F AL ENINI MISTSEIK++ +IEEKY ELAVR LH AF L+ GN Sbjct: 360 FAALHAENINILMISTSEIKITCLIEEKYTELAVRTLHDAFGLNHDLGN 408 Lambda K H 0.317 0.133 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 451 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 412 Length of database: 409 Length adjustment: 31 Effective length of query: 381 Effective length of database: 378 Effective search space: 144018 Effective search space used: 144018 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate 8499506 DvMF_0276 (aspartate kinase (RefSeq))
to HMM TIGR00656 (aspartate kinase, monofunctional class (EC 2.7.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00656.hmm # target sequence database: /tmp/gapView.15524.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00656 [M=407] Accession: TIGR00656 Description: asp_kin_monofn: aspartate kinase, monofunctional class Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-136 439.1 5.8 9.5e-136 438.9 5.8 1.0 1 lcl|FitnessBrowser__Miya:8499506 DvMF_0276 aspartate kinase (RefS Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8499506 DvMF_0276 aspartate kinase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 438.9 5.8 9.5e-136 9.5e-136 1 405 [. 1 401 [. 1 403 [. 0.98 Alignments for each domain: == domain 1 score: 438.9 bits; conditional E-value: 9.5e-136 TIGR00656 1 veliVqKFGGtsvgsserikkaakivlkelkegkkvvVVvSAmskvtdelvelaellklleaisdeisprerdelvs 77 + + VqKFGGtsv++ e +k++ ++v ++l++g+k+vVV+SA s++t++l++la e s ++ p+e d l++ lcl|FitnessBrowser__Miya:8499506 1 MRILVQKFGGTSVANLECMKQVREKVRRALRDGYKPVVVLSARSGETNRLLALA------EEWSTDPDPAEVDALIA 71 5799**************************************************......799************** PP TIGR00656 78 vGEllssallssalrelgvkaealdgkeagilTddefgnAkikelateerLlelLeegiivvvaGFiGateeGeiTt 154 +GE++s+al+s++l++ g ka++++g + +i T+d fg+A+i +++ +rL + Le ++++vvaGF+G t+eG++Tt lcl|FitnessBrowser__Miya:8499506 72 TGEQVSVALFSMLLKDSGIKARSMTGFQVPITTSDAFGRARIMDIDA-SRLRKELETHDVIVVAGFQGVTSEGRVTT 147 ***********************************************.***************************** PP TIGR00656 155 LGRGGSDltAallaaalkAdrveiyTDVeGvyttDPrvveeakkidkisyeEalelAtlGakvlhpralelaveakv 231 LGRGGSD++A++laaal ++eiyTDV+GvyttDP++ ++a+k+d++sy+E+le+A++Gakvl+ r++e+a+++kv lcl|FitnessBrowser__Miya:8499506 148 LGRGGSDTSAVALAAALGSVECEIYTDVDGVYTTDPNLCSTARKLDRVSYDEMLEMASMGAKVLQIRSVEFAKKYKV 224 ***************************************************************************** PP TIGR00656 232 pilvrsskekeegTlitn...kkensslvkaialeknvarltvegegmlgkrgilaeifkaLaeeeinvdlisqtes 305 p+ vrs++ gT +t+ ++e lv++ia++k++ar+t++ ++ +k+g+ a if+ L++++i vd+i+q +s lcl|FitnessBrowser__Miya:8499506 225 PVHVRSTFTDTPGTMVTQedcEMEA-VLVSGIAYDKDQARVTLR--SVPDKPGVSAAIFGPLSQQGILVDMIVQNPS 298 *****************98544444.5*****************..9****************************** PP TIGR00656 306 e...tsislvvdeedvdeakkaLkeesgaaelesleveedlavvsivgaglveapGvaseifkaleekninilmiss 379 + t+++++v ++d++++ ++++e ++ +++ + ++a+vs++g+g+++++Gva+++f+al+ +ninilmis+ lcl|FitnessBrowser__Miya:8499506 299 RdgvTDMTFTVPRKDLKKTLALMEEIRARTGAQEVLHDTQVAKVSAIGVGMRNHSGVAAKAFAALHAENINILMIST 375 9999***********************999*********************************************** PP TIGR00656 380 setkisvlvdekdaekavrklhekle 405 se+ki+ l++ek++e avr+lh+++ lcl|FitnessBrowser__Miya:8499506 376 SEIKITCLIEEKYTELAVRTLHDAFG 401 ***********************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (407 nodes) Target sequences: 1 (409 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.74 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory