Align Phosphoserine phosphatase 1; PSP 1; PSPase 1; Metal-independent phosphoserine phosphatase 1; iPSP1; O-phosphoserine phosphohydrolase 1; EC 3.1.3.3 (characterized)
to candidate 8500719 DvMF_1462 phosphoglycerate mutase 1 family (RefSeq)
Query= SwissProt::D3DFG8 (211 letters) >FitnessBrowser__Miya:8500719 Length = 249 Score = 48.1 bits (113), Expect = 1e-10 Identities = 35/108 (32%), Positives = 54/108 (50%), Gaps = 5/108 (4%) Query: 1 MVKLILVRHAESEWNPVGRYQGLLDPDLSERGKKQAKLLAQELSREHL--DVIYSSPLKR 58 M L+L+RH +S WN R+ G D DLS G+++A+ A+ L+ E L DV ++S L R Sbjct: 1 MHTLVLLRHGQSAWNLENRFTGWTDVDLSPEGEQEARDAARLLTDEGLTFDVCHTSVLTR 60 Query: 59 TYLTALEIAEAKNLE---VIKEDRIIEIDHGMWSGMLVEEVMEKYPED 103 T + L V K R+ E +G G+ E ++ E+ Sbjct: 61 AIRTLYIVQHEMGLSWLPVHKHWRLNERHYGGLQGLDKAETAARFGEE 108 Lambda K H 0.320 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 211 Length of database: 249 Length adjustment: 23 Effective length of query: 188 Effective length of database: 226 Effective search space: 42488 Effective search space used: 42488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory