Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate 5207692 Shew_0214 3-dehydroquinate synthase (RefSeq)
Query= BRENDA::P07639 (362 letters) >FitnessBrowser__PV4:5207692 Length = 358 Score = 421 bits (1083), Expect = e-122 Identities = 212/357 (59%), Positives = 265/357 (74%), Gaps = 1/357 (0%) Query: 1 MERIVVTLGERSYPITIASGLFNEPASFLPLKSGEQVMLVTNETLAPLYLDKVRGVLEQA 60 ME+I V LG RSYPI I L F G+++++VTN+T+APLYL KV+ +L Sbjct: 1 MEQIQVELGVRSYPIFIGQNLLENSDYFSSYLQGKKILIVTNDTIAPLYLAKVQALLASY 60 Query: 61 GVNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQR 120 D VILPDGEQYK+L+ +D +FT+LL + GRD+ L+ALGGGV+GD+TGFAAA YQR Sbjct: 61 QC-ADPVILPDGEQYKTLSQMDAIFTSLLAQNMGRDSVLIALGGGVIGDMTGFAAACYQR 119 Query: 121 GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELAS 180 GV FIQ+PTTLLSQVDSSVGGKTAVNHP+GKNMIGAFYQP V +D CL TLP RE A+ Sbjct: 120 GVDFIQIPTTLLSQVDSSVGGKTAVNHPMGKNMIGAFYQPKMVAIDTACLHTLPAREFAA 179 Query: 181 GLAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLR 240 G+AEVIKYGII DG+FF+WLE+N+ AL LD A+ Y I +CC++KA+VVA DE E G+R Sbjct: 180 GMAEVIKYGIIWDGSFFSWLEQNVAALKSLDEAALTYAIAKCCQIKADVVAQDETEQGVR 239 Query: 241 ALLNLGHTFGHAIEAEMGYGNWLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLLKRA 300 ALLNLGHTFGHAIEAEMGYG WLHGEAVAAG V+AA+T+ ++G + RI + + Sbjct: 240 ALLNLGHTFGHAIEAEMGYGVWLHGEAVAAGTVLAAQTASKMGLVDQSIVCRIEAIFEAF 299 Query: 301 GLPVNGPREMSAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRSGVSHELVLNAIA 357 LP P M + ++ HM RDKKVL G++RL+LP AIG++EV VS L+ I+ Sbjct: 300 DLPTEAPEAMDFEQFIKHMRRDKKVLNGKLRLVLPKAIGQAEVYGEVSESLLQEVIS 356 Lambda K H 0.320 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 323 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 358 Length adjustment: 29 Effective length of query: 333 Effective length of database: 329 Effective search space: 109557 Effective search space used: 109557 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 5207692 Shew_0214 (3-dehydroquinate synthase (RefSeq))
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.30019.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-125 402.2 0.0 1.1e-124 402.1 0.0 1.0 1 lcl|FitnessBrowser__PV4:5207692 Shew_0214 3-dehydroquinate synth Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5207692 Shew_0214 3-dehydroquinate synthase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 402.1 0.0 1.1e-124 1.1e-124 1 341 [. 13 353 .. 13 356 .. 0.95 Alignments for each domain: == domain 1 score: 402.1 bits; conditional E-value: 1.1e-124 TIGR01357 1 ykvkvgegllkklveelae..kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletvaklldqll 76 y++ +g++ll++ +++++ + +k++++t+++++ l+ +k++++l+s + ++ +++pdge++K+l+++ ++ + ll lcl|FitnessBrowser__PV4:5207692 13 YPIFIGQNLLENS-DYFSSylQGKKILIVTNDTIAPLYLAKVQALLAS-YQCADPVILPDGEQYKTLSQMDAIFTSLL 88 6789999999843.3444444569**********************98.67788999********************* PP TIGR01357 77 eeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgkNliGafyqPkaVlidl 154 ++++ r+svl+a+GGGv+gD++GF+Aa y+RG++++q+PTtll++vDssvGGKt++n+p gkN+iGafyqPk+V id+ lcl|FitnessBrowser__PV4:5207692 89 AQNMGRDSVLIALGGGVIGDMTGFAAACYQRGVDFIQIPTTLLSQVDSSVGGKTAVNHPMGKNMIGAFYQPKMVAIDT 166 ****************************************************************************** PP TIGR01357 155 kvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeelikrsievKaevVeeDekesglRalLN 232 ++l+tlp re+++GmaEviK+g+i+d ++f++le+n ++l++l +++al+ +i++++++Ka+vV++De+e+g+RalLN lcl|FitnessBrowser__PV4:5207692 167 ACLHTLPAREFAAGMAEVIKYGIIWDGSFFSWLEQNVAALKSL-DEAALTYAIAKCCQIKADVVAQDETEQGVRALLN 243 *************************************988865.66******************************** PP TIGR01357 233 fGHtlgHaiEallkyk.lsHGeaVaiGmvveaklseklgllkaellerlvallkklglptklkkklsveellkallkD 309 +GHt+gHaiEa+++y+ + HGeaVa G v++a+++ k+gl++++++ r++a+++++ lpt+ ++ +++e+++k++ +D lcl|FitnessBrowser__PV4:5207692 244 LGHTFGHAIEAEMGYGvWLHGEAVAAGTVLAAQTASKMGLVDQSIVCRIEAIFEAFDLPTEAPEAMDFEQFIKHMRRD 321 ****************************************************************************** PP TIGR01357 310 KKnegskiklvlleeiGkaalasevteeelle 341 KK ++k++lvl+++iG+a++ ev+e+ l+e lcl|FitnessBrowser__PV4:5207692 322 KKVLNGKLRLVLPKAIGQAEVYGEVSESLLQE 353 ********************998887665554 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (358 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 12.20 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory