Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate 5208556 Shew_1067 phospho-2-dehydro-3-deoxyheptonate aldolase (RefSeq)
Query= BRENDA::P00888 (356 letters) >FitnessBrowser__PV4:5208556 Length = 363 Score = 466 bits (1200), Expect = e-136 Identities = 227/356 (63%), Positives = 282/356 (79%) Query: 1 MQKDALNNVHITDEQVLMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCG 60 MQ+D +NNVHI+ E+VL+TPE+LK PLS + ++R+++SDI+ RD R+LVV G Sbjct: 1 MQQDTINNVHISSEKVLVTPEELKQQLPLSTAAYHYVLNARRTVSDIVHKRDNRVLVVSG 60 Query: 61 PCSIHDPETALEYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDV 120 PCSIHD +A EYA R K L E+ D Y++MRVYFEKPRTTVGWKG+INDP MD SFDV Sbjct: 61 PCSIHDIASAKEYALRLKTLHDELKDEFYILMRVYFEKPRTTVGWKGMINDPDMDESFDV 120 Query: 121 EAGLQIARKLLLELVNMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGL 180 E GL+ AR+L++ L +GLP+ATEALDP SPQY+ +L +WSAIGARTTESQTHREMASGL Sbjct: 121 EKGLRQARELMIWLAELGLPVATEALDPISPQYISELVTWSAIGARTTESQTHREMASGL 180 Query: 181 SMPVGFKNGTDGSLATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGGKAP 240 SMPVGFKNGTDG L AINA+++AA HRF+GINQAGQVALLQT GNPDGHVILRGGK P Sbjct: 181 SMPVGFKNGTDGKLGVAINALQSAASSHRFMGINQAGQVALLQTAGNPDGHVILRGGKTP 240 Query: 241 NYSPADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGL 300 NY + VA+CE+++ A L L+VDCSHGNS+KD+ RQP+V + V QI +GN+SIIG+ Sbjct: 241 NYDASSVAECEQQLHAAKLNARLVVDCSHGNSSKDHTRQPSVCQDVFDQIANGNKSIIGV 300 Query: 301 MIESNIHEGNQSSEQPRSEMKYGVSVTDACISWEMTDALLREIHQDLNGQLTARVA 356 M+ES+++EGNQSS++P SE+ YGVSVTDACI W+ T+ LLR+ L L R A Sbjct: 301 MLESHLNEGNQSSDKPMSELAYGVSVTDACIDWQTTEDLLRQGAAQLASVLPGRFA 356 Lambda K H 0.316 0.131 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 363 Length adjustment: 29 Effective length of query: 327 Effective length of database: 334 Effective search space: 109218 Effective search space used: 109218 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate 5208556 Shew_1067 (phospho-2-dehydro-3-deoxyheptonate aldolase (RefSeq))
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.17257.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-160 518.4 0.1 3.8e-160 518.2 0.1 1.0 1 lcl|FitnessBrowser__PV4:5208556 Shew_1067 phospho-2-dehydro-3-de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5208556 Shew_1067 phospho-2-dehydro-3-deoxyheptonate aldolase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 518.2 0.1 3.8e-160 3.8e-160 4 338 .. 10 347 .. 4 351 .. 0.96 Alignments for each domain: == domain 1 score: 518.2 bits; conditional E-value: 3.8e-160 TIGR00034 4 rivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakrlkklaeklkdd 81 +i + + l+tPeelk++ pl+++a + v ++r++++di++ +d+r+lvv GPcsihd +a+eya rlk+l ++lkd+ lcl|FitnessBrowser__PV4:5208556 10 HISSEKVLVTPEELKQQLPLSTAAYHYVLNARRTVSDIVHKRDNRVLVVSGPCSIHDIASAKEYALRLKTLHDELKDE 87 344446688********************************************************************* PP TIGR00034 82 leivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatelldtispqyladllswgaiGa 159 ++i+mrvyfekPrttvGWkG+indPd++esfdv+kGlr ar+l++ l+elglp+ate+ld+ispqy+++l++w+aiGa lcl|FitnessBrowser__PV4:5208556 88 FYILMRVYFEKPRTTVGWKGMINDPDMDESFDVEKGLRQARELMIWLAELGLPVATEALDPISPQYISELVTWSAIGA 165 ****************************************************************************** PP TIGR00034 160 rttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvtkaGqvaivetkGnedghiilrGGkkpnyd 237 rttesq+hre+asgls+pvgfkngtdG+l vai+a+++aa++h+f+++++aGqva+++t+Gn+dgh+ilrGGk+pnyd lcl|FitnessBrowser__PV4:5208556 166 RTTESQTHREMASGLSMPVGFKNGTDGKLGVAINALQSAASSHRFMGINQAGQVALLQTAGNPDGHVILRGGKTPNYD 243 ****************************************************************************** PP TIGR00034 238 aedvaevkeelekaglkeelmidfshgnsnkdykrqlevaesvveqiaeGekaiiGvmiesnleeGnqsl...keelk 312 a++vae++++l++a+l+++l++d+shgns+kd+ rq++v+++v +qia+G+k+iiGvm+es+l+eGnqs+ +el+ lcl|FitnessBrowser__PV4:5208556 244 ASSVAECEQQLHAAKLNARLVVDCSHGNSSKDHTRQPSVCQDVFDQIANGNKSIIGVMLESHLNEGNQSSdkpMSELA 321 *********************************************************************943345789 PP TIGR00034 313 yGksvtdacigwedteallrklaeav 338 yG+svtdaci+w++te+llr+ a+++ lcl|FitnessBrowser__PV4:5208556 322 YGVSVTDACIDWQTTEDLLRQGAAQL 347 ********************977665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (363 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.09 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory