Align shikimate kinase (EC 2.7.1.71) (characterized)
to candidate 5207691 Shew_0213 shikimate kinase I (RefSeq)
Query= BRENDA::P0A6D7 (173 letters) >FitnessBrowser__PV4:5207691 Length = 171 Score = 264 bits (674), Expect = 7e-76 Identities = 133/170 (78%), Positives = 152/170 (89%), Gaps = 1/170 (0%) Query: 1 MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDLEGEEGFR 60 MAEKRNIFLVGPMGAGKSTIGR LAQ L++EF+DSDQEIE RTGAD+ WVFD+EGEEGFR Sbjct: 1 MAEKRNIFLVGPMGAGKSTIGRHLAQMLHLEFHDSDQEIENRTGADIAWVFDVEGEEGFR 60 Query: 61 DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR 120 RE +V+ +LTEKQGIVLATGGGS++S++ RN LSARG+VVYLETTI+KQ+ARTQRDK+R Sbjct: 61 RRETQVVADLTEKQGIVLATGGGSIQSKDIRNNLSARGIVVYLETTIDKQVARTQRDKRR 120 Query: 121 PLLHVETPPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHML 170 PLL VE PREVLE LA RNPLYEEIADV ++TD+QSAKVVANQII L Sbjct: 121 PLLQVE-DPREVLEKLAEIRNPLYEEIADVIVKTDEQSAKVVANQIIDQL 169 Lambda K H 0.313 0.132 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 173 Length of database: 171 Length adjustment: 18 Effective length of query: 155 Effective length of database: 153 Effective search space: 23715 Effective search space used: 23715 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory