Align N-succinylcitrulline desuccinylase (EC 3.5.1.-) (characterized)
to candidate CA265_RS00205 CA265_RS00205 acetylornithine deacetylase
Query= reanno::Pedo557:CA265_RS18500 (355 letters) >FitnessBrowser__Pedo557:CA265_RS00205 Length = 366 Score = 410 bits (1053), Expect = e-119 Identities = 199/347 (57%), Positives = 259/347 (74%) Query: 3 LENIQKESLDLLRQLIRIQSFSKEEDRTANLIAQFLEERGIKTQRKMNNVWAYNKHFDAT 62 L ++ +ESL+LL LI I S S +E TA+ I FL +GI T RK NN+W YNK+ DA+ Sbjct: 15 LNHLYQESLELLSSLISIPSISGDEMLTADQIETFLNLQGINTFRKHNNIWCYNKYMDAS 74 Query: 63 KPTLLLNSHHDTVKPNSGYTRDPYDAAIEGDKLFGLGSNDAGGCLVSLIGTFLYYYEQEG 122 KPT+LLNSHHDTV+PN YTRDP+ IE +K++GLGSNDAGG LV+L TFLY++E++ Sbjct: 75 KPTILLNSHHDTVRPNEQYTRDPFSPIIEEEKIYGLGSNDAGGPLVALTATFLYFFERKD 134 Query: 123 LKYNICLAATAEEEISGNNGLELVLPDLGELEFGIVGEPTEMNLAIAERGLLVLDCVSHG 182 L +N+CLAATAEEE SG G+ +LPDL E+ F IVGEPT M++AIAE+G +V+DCVS G Sbjct: 135 LSFNLCLAATAEEETSGELGIRSILPDLKEISFAIVGEPTGMHMAIAEKGSMVIDCVSKG 194 Query: 183 KAGHAAREEGENAIYKALKDIEWFRNYQFPKVSEVFGPLKMTVTIINAGSQHNVVPANCT 242 ++GHAAREEG+NAIY ALKDI+WF++Y FP + + P+KMTVT I AG QHN+VPA C+ Sbjct: 195 RSGHAAREEGDNAIYHALKDIDWFKSYLFPIMDDQPQPVKMTVTEIRAGIQHNIVPAECS 254 Query: 243 FTVDVRVTDAYTNEEVLEIIRANVDCDVTPRSIRLKPSSIDKNHPVVQAGVALGKTTYGS 302 FTVD+R Y E++ I + C T R LKPS ID HPVV +G++LG+ TY S Sbjct: 255 FTVDIRFDHNYNEREIVNTIINHTSCHFTVRPNVLKPSFIDMLHPVVVSGLSLGRKTYLS 314 Query: 303 PTTSDQALLDIPSVKCGPGFSGRSHMADEFLYVREVAEGVEGYVNML 349 PT+SDQ LD+PSVK GPG S RSH ADEF+ + E+ EG++ Y+++L Sbjct: 315 PTSSDQGWLDMPSVKMGPGNSARSHTADEFIGIEEIEEGIDIYISLL 361 Lambda K H 0.317 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 366 Length adjustment: 29 Effective length of query: 326 Effective length of database: 337 Effective search space: 109862 Effective search space used: 109862 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory