Align N-succinylornithine carbamoyltransferase (EC 2.1.3.11) (characterized)
to candidate CA265_RS18520 CA265_RS18520 acetylornithine carbamoyltransferase
Query= reanno::Cola:Echvi_3849 (313 letters) >FitnessBrowser__Pedo557:CA265_RS18520 Length = 324 Score = 348 bits (894), Expect = e-101 Identities = 173/321 (53%), Positives = 226/321 (70%), Gaps = 8/321 (2%) Query: 1 MKYYTQFENKSLADQLIQKALEYKKAPLSDNNLGRGKRIGLLFLNPSLRTRVSTQIAASN 60 MK +T + Q + AL K P + +LG+ K +GL+F+NPSLRTR+STQ AA N Sbjct: 1 MKLFTSVHDVPSIKQFVNDALALKANPYAHQDLGKNKTLGLVFMNPSLRTRLSTQKAALN 60 Query: 61 LGMESIVLNMDKESWALEMEDGVIMNQGKAEHIRDAAGVLGSYFDILALRAFPSLTNKDE 120 LGM +V+N+DKE WALE +DGV+MN EHIR+AA V+G Y DIL LR+FP L N++E Sbjct: 61 LGMNVMVMNLDKEGWALETQDGVVMNGSTVEHIREAAAVMGQYCDILGLRSFPKLNNREE 120 Query: 121 DSEDFILHQFAKHSGLPLISLESAIRHPLQSLADMVTIQEHKQKE----KPKVVLTWAPH 176 D + ++F K+ +P++SLESA RHPLQS AD++TI E K+ KPKVVL WAPH Sbjct: 121 DYSEDFFNKFVKYCAVPVVSLESATRHPLQSFADIITIHETWTKKPDGRKPKVVLAWAPH 180 Query: 177 IKAIPHAVANSFAEWSIGCGH----DVTITHPEGYELDERFTQGATIEHDQDKALANADF 232 +KA+P AV NSFAEW D TI PEGYEL E FT A I+++ ++ALA AD+ Sbjct: 181 VKALPQAVPNSFAEWMCKAQAEGMIDFTIAQPEGYELSEDFTPDANIQYNLEEALAGADY 240 Query: 233 VYVKNWSAFNEYGKILCTDESWMLNEQKLSQAPNAKVMHCLPVRRNVELSDEILDGPRSL 292 VYVKNWS++ EYGK+L + WM+N +KL +AKVMHCLPVRR++ELS EILDGP SL Sbjct: 241 VYVKNWSSYKEYGKVLTYPDGWMMNNEKLKFTNDAKVMHCLPVRRDLELSSEILDGPNSL 300 Query: 293 VQHQAKNRVFAAQAALSELLK 313 V H+A NR++AAQA + +L+ Sbjct: 301 VIHEAGNRLWAAQAVIKAMLE 321 Lambda K H 0.317 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 324 Length adjustment: 27 Effective length of query: 286 Effective length of database: 297 Effective search space: 84942 Effective search space used: 84942 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory